DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CYP3A7 and Cyp4d20

Sequence 1:NP_000756.3 Gene:CYP3A7 HGNCID:2640 Length:503 Species:Homo sapiens
Sequence 2:NP_647723.2 Gene:Cyp4d20 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster

Alignment Length:501 Identity:148/502 (29%)
Similarity:254/502 (51%) Gaps:51/502 (10%)


Human    12 WLLL---AVSLILLYLYGTRTHGL--FKKLGIPGPTPLPFLGNAL-SFRKGY-----WTFDMECY 65
            ||.|   |:.|:|.:.:|.:...:  |:|..||||..:|.||..| :...|.     |.  .|.:
  Fly     2 WLTLITGALILLLTWDFGRKRQRVLAFEKSAIPGPISIPILGCGLQALHLGAENIIGWV--GEKF 64

Human    66 KKYRKVWGIYDCQQPMLAITDPDMIKTVL----VKECYSVFTNRRPFGPVGFMKNAISIAEDEEW 126
            .||.|.:..:...:.::...|....:|:|    :.|...::...||     |:.:.:.::...:|
  Fly    65 DKYGKTFRFWILGESLIYTKDLQYFETILSSTTLLEKGQLYEYLRP-----FLNDGLLVSTGRKW 124

Human   127 KRIRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVT--LKHVFGAYSMDVITSTSF 189
            ...|.:.:..|....|:..|.|:.::..|:|.|||:.|: ||...  ||:|..| ::||||..:.
  Fly   125 HARRKIFTHAFHFKVLEHYVEIMDRHSSVMVDNLRKVAD-GKTAVDMLKYVSLA-ALDVITEAAM 187

Human   190 GVSIDSLNNPQDPFVENTKKLLRFNPLDPFVLSIK---VFPFLTPILE---ALNITV---FPRKV 245
            ||.:::.|:|..|:::..|.::...|...|..|.:   :||...|:|.   ..:|.|   |..||
  Fly   188 GVQVNAQNDPDFPYIKALKSVVYIQPDRMFRFSRRYNWLFPLAAPLLHRQLLSDIRVMHDFTDKV 252

Human   246 ISFLTKSVKQIKE---------GRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSII 301
            ||...::|::.|.         |..:...|.::..|.:::.|     |..::.|||.::..:...
  Fly   253 ISERRETVRRAKADGTYRPLSLGDAEIGSKSQMALLDILLQS-----SINNQPLSDADIREEVDT 312

Human   302 FIFAGYETTSSVLSFIIYELATHPDVQQKVQKEIDTVL-PNKAPPTYDTVLQ-LEYLDMVVNETL 364
            |:|.|.:||||.:|..:|.:|.||:|||::.:|:..|| |:.:.|.....|| |:|||.|:.||:
  Fly   313 FMFEGDDTTSSGVSHALYAIARHPEVQQRIFEELQRVLGPDASAPVTQAQLQDLKYLDCVIKETM 377

Human   365 RLFPVAMRLERVCKKDVEINGMFIPKGVVVMIPSYVLHHDPKYWTEPEKFLPERFSKKNKDNIDP 429
            ||:|....:.|..:|::||....||....:.:..|..|.|..|:.:|..|.||||.:..:...:.
  Fly   378 RLYPPVPAIGRHAQKELEIGDKTIPANTSIYLVLYYAHRDANYFPDPLSFRPERFLEDQEQGHNT 442

Human   430 YIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPL 475
            :.|.||.:||:||||.:||::.||:.:.:||:.:...|..|...|:
  Fly   443 FAYVPFSAGPKNCIGQKFAVLEMKVLISKVLRFYELLPLGEELKPM 488

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CYP3A7NP_000756.3 p450 39..492 CDD:306555 138/470 (29%)
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 138/470 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.