DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CYP3A7 and Cyp6a8

Sequence 1:NP_000756.3 Gene:CYP3A7 HGNCID:2640 Length:503 Species:Homo sapiens
Sequence 2:NP_523749.2 Gene:Cyp6a8 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster

Alignment Length:516 Identity:156/517 (30%)
Similarity:262/517 (51%) Gaps:45/517 (9%)


Human    11 TWLLLAVSLILL-----YLYGTRTHGLFKKLGIPGPTPLPFLGN--ALSFRKGYWTFDMECYKKY 68
            |::|..|::.||     |::...|:  ||:.|||...|....||  .|...|.......:.|.|:
  Fly     4 TYILFQVAVALLAILTYYIHRKLTY--FKRRGIPFVAPHLIRGNMEELQKTKNIHEIFQDHYNKF 66

Human    69 RK----VWGIYDCQQPMLAITDPDMIKTVLVKECYSVFTNRRPF-----GPV-GFMKNAISIAED 123
            |:    ..|.:..|.|...:.|.::.|.:|:|: :|.|:|:..|     .|: ..:.|    .:.
  Fly    67 RESKAPFVGFFFFQSPAAFVIDLELAKQILIKD-FSNFSNKGIFYNEKDDPISAHLFN----LDG 126

Human   124 EEWKRIRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKHVFGAYSMDVITSTS 188
            .:|:.:|:.||.||||||:|.|.|.:....:..:..:..:......:.::.:...:::|||.:.:
  Fly   127 AQWRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHEKVPKNSVLEIRDLVARFTVDVIGTCA 191

Human   189 FGVSIDSLNNPQDPFVENTKKLL----RFNPLDPFVLSIKVFPFLTPILEALNITVFPRKVISFL 249
            ||:..:||.:.:..|:...|:.|    ....|:.|:.|   :|.|.   ..|.:......:..|.
  Fly   192 FGIQCNSLRDEKAEFLYFGKRSLVDKRHGTLLNGFMRS---YPKLA---RKLGMVRTAPHIQEFY 250

Human   250 TKSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKD-----SETHKALSDLELMAQSIIFIFAGYET 309
            ::.|.:....|.||..| |.||:.::|:.:|.|:     .:..:.|:..|::||:.:|..||:||
  Fly   251 SRIVTETVAVREKEHIK-RNDFMDMLIELKNQKEMTLENGDVVRGLTMEEVLAQAFVFFIAGFET 314

Human   310 TSSVLSFIIYELATHPDVQQKVQKEIDTVLPNKAPP-TYDTVLQLEYLDMVVNETLRLFPVAMRL 373
            :||.:.|.:||||.:||:|.||:.|::.|:...... ||:....|:||:.|::|||||:.:...|
  Fly   315 SSSTMGFALYELAKNPDIQDKVRAEVEEVIEQHDQNFTYECTKDLKYLNQVLDETLRLYTIVPNL 379

Human   374 ERVCKKDVEING---MFIPKGVVVMIPSYVLHHDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPF 435
            :|:..|...:.|   ..|..|..|:|||..:||||..:.||.:|.|||||.:.........:.||
  Fly   380 DRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIHHDPSIYPEPFEFRPERFSPEESAGRPSVAWLPF 444

Human   436 GSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKP-IVLKAES 495
            |.|||||||:||..:..::.|..:::||.|..|.:|..||.......:|..|. |.||.|:
  Fly   445 GDGPRNCIGLRFGQMQARIGLALLIRNFKFSTCSKTPNPLVYDPKSFVLGVKDGIYLKVET 505

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CYP3A7NP_000756.3 p450 39..492 CDD:306555 143/479 (30%)
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 143/476 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.