DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsd17b1 and CG31937

Sequence 1:NP_034605.1 Gene:Hsd17b1 MGIID:105077 Length:344 Species:Mus musculus
Sequence 2:NP_608616.2 Gene:CG31937 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster

Alignment Length:290 Identity:77/291 (26%)
Similarity:117/291 (40%) Gaps:53/291 (18%)


Mouse     5 VVLITGCSSGIGMHLAVRLASDRSQSFKVYATLRDL----KAQGPLLEAARTQGCPPGSLE---- 61
            ||.|||.|||||..||:.||   ....|:..:.|.|    :.|...|.|||      |.|.    
  Fly    48 VVWITGASSGIGRALALSLA---RHGVKLVLSARRLEQLEQVQEECLAAAR------GLLATKDV 103

Mouse    62 -ILELDVRDSKSVAAAQACVTE--GRVDVLVCNAGRGLFGPLEAHELNAVGAVLDVNVLGTIRML 123
             ::::|:.|..........|..  .|:||||.||||.........|:.....:.:::|...:.:.
  Fly   104 LVIQMDMLDLDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLS 168

Mouse   124 QAFLPDMKRRHSGR--VLVTASVGGLMGLPFHEVYCASKFALEGLCESLAILLPLFGVHVSLIEC 186
            :..:.....::.||  :..|:|:.|...:||...|||:|.||.....||.:  .:..:.|||...
  Fly   169 RLVVRYFVEQNGGRGHIAATSSIAGFSPVPFSPTYCAAKHALNAYLLSLKV--EMRKLDVSLFAP 231

Mouse   187 GAVHTAF-YEKLVGGPGGALERADAQTRHLFAHYLRGYEQALSEAQDPEEVTELFLTAMR----- 245
            |.:.|.| .|...|..||.:..:.|..:.:.|                :...:||..|:.     
  Fly   232 GPIATDFLQEAFTGSQGGKVGLSTANQKRMTA----------------QRCGDLFAVALANKMDL 280

Mouse   246 -----APQPALRYFSTNRFLP--LARMRTE 268
                 .|...|.|.:.|..|.  ||::.||
  Fly   281 TWCGLFPVNLLAYCARNPTLSKILAQLMTE 310

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsd17b1NP_034605.1 NADB_Rossmann 4..260 CDD:304358 72/279 (26%)
adh_short 5..192 CDD:278532 58/200 (29%)
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 70/272 (26%)
adh_short 47..245 CDD:278532 60/208 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.