DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsd11b1 and CG31937

Sequence 1:XP_006497290.1 Gene:Hsd11b1 MGIID:103562 Length:333 Species:Mus musculus
Sequence 2:NP_608616.2 Gene:CG31937 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster

Alignment Length:248 Identity:67/249 (27%)
Similarity:113/249 (45%) Gaps:33/249 (13%)


Mouse    48 YLLPILVLFLAYY-------------YYSTNEEFRPEMLQGKKVIVTGASKGIGREMAYHLSKMG 99
            :||.:|||:...|             :|.:........::|:.|.:||||.||||.:|..|::.|
  Fly     6 FLLLLLVLYYVVYVLLWILLDCNVALWYKSRFGVSLSSMRGQVVWITGASSGIGRALALSLARHG 70

Mouse   100 AHVVLTARSEEGLQKVVSRCLELGAASAHYIAGTME------DMTFAEQFIVKAGKLMG---GLD 155
            ..:||:||..|.|::|...||    |:|..:..|.:      ||...::.......::.   .||
  Fly    71 VKLVLSARRLEQLEQVQEECL----AAARGLLATKDVLVIQMDMLDLDEHKTHLNTVLNHFHRLD 131

Mouse   156 MLILNHITQTSLSLFHDDIHSVRRVMEVNFLSYVVMSTAALPMLKQSNGS---IAVISSLAGKMT 217
            :|:.|.......|....:|...|.:.|::..:.|.:|...:....:.||.   ||..||:||...
  Fly   132 VLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFVEQNGGRGHIAATSSIAGFSP 196

Mouse   218 QPMIAPYSASKFALDGFFSTIRTELYITKVNVSITLCVLGLIDTETAMKEISG 270
            .|....|.|:|.||:.:..:::.|:  .|::||  |...|.|.|:...:..:|
  Fly   197 VPFSPTYCAAKHALNAYLLSLKVEM--RKLDVS--LFAPGPIATDFLQEAFTG 245

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsd11b1XP_006497290.1 11beta-HSD1_like_SDR_c 73..320 CDD:187593 60/211 (28%)
adh_short 76..266 CDD:278532 58/202 (29%)
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 60/211 (28%)
adh_short 47..245 CDD:278532 58/206 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.