DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hoxd8 and zen2

Sequence 1:NP_032302.2 Gene:Hoxd8 MGIID:96209 Length:289 Species:Mus musculus
Sequence 2:NP_476794.1 Gene:zen2 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster

Alignment Length:112 Identity:50/113 (44%)
Similarity:61/113 (54%) Gaps:18/113 (16%)


Mouse   175 NQSSSPSQMFPW--MRPQAAP--------GRRRGRQTYSRFQTLELEKEFLFNPYLTRKRRIEVS 229
            |.|.|...|:|.  :..:|||        ..:|.|..:|..|.:|||:||..|.||.|.||||:|
  Fly    13 NYSVSDLMMYPCVELNVEAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEIS 77

Mouse   230 HTLALTERQVKIWFQNRRMKWKKENNK--------DKFPASRPEAKD 268
            ..||||||||||||||||||.||..|:        ...|.|...::|
  Fly    78 QRLALTERQVKIWFQNRRMKLKKSTNRKGAIGALTTSIPLSSQSSED 124

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hoxd8NP_032302.2 COG5576 139..272 CDD:227863 50/113 (44%)
Antp-type hexapeptide 183..188 2/7 (29%)
Homeobox 199..251 CDD:278475 35/52 (67%)
zen2NP_476794.1 Homeobox 46..99 CDD:278475 35/53 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.