DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hoxd8 and unpg

Sequence 1:NP_032302.2 Gene:Hoxd8 MGIID:96209 Length:289 Species:Mus musculus
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:329 Identity:83/330 (25%)
Similarity:107/330 (32%) Gaps:113/330 (34%)


Mouse    18 AAAAAAAAAAAGEAINPTYY--------------------DCHFAPEVSGRHAAALQLYGNSAAG 62
            :|.|..|::|.|....|.|.                    .|:.....:| |.||.|....:...
  Fly    67 SARAMVASSALGLTQFPLYNPWLHGYFAQNHERLTHLIAGGCYLPSSPAG-HPAAQQPQAQAQPQ 130

Mouse    63 FPHAHPHPH----------PHPSPP---PGCGGGGGPGP------------GQDYFH-------- 94
            .|..||..|          |||...   |......|..|            .|||.|        
  Fly   131 PPPPHPPTHALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARL 195

Mouse    95 ---AGAG-------SPTAAYQAAPPPPHPPPPP-------PPPP-----------CGGIACHG-- 129
               |.||       :|..|....|.||.....|       |..|           |.|.:|..  
  Fly   196 QHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDIS 260

Mouse   130 ---EPAKFYGYDNLQRQPIFTTQQEAELVQYPDC--------KSSSGNIGEDPDHLNQSSSPSQM 183
               .|..:.|..:..|...:|....      .||        :...|.:|......|.|||.|: 
  Fly   261 LTMSPRNYNGEMDKSRNGAYTNSDS------EDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSK- 318

Mouse   184 FPWMRPQAAPGRRRGRQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHTLALTERQVKIWFQNRRM 248
                       .||.|..::..|.||||:||....||:...|.:::.:|.|:|.||||||||||.
  Fly   319 -----------SRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRA 372

Mouse   249 KWKK 252
            |||:
  Fly   373 KWKR 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hoxd8NP_032302.2 COG5576 139..272 CDD:227863 40/123 (33%)
Antp-type hexapeptide 183..188 0/5 (0%)
Homeobox 199..251 CDD:278475 26/52 (50%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.