DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hoxd4 and unpg

Sequence 1:NP_034599.2 Gene:Hoxd4 MGIID:96208 Length:250 Species:Mus musculus
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:111 Identity:44/112 (39%)
Similarity:63/112 (56%) Gaps:11/112 (10%)


Mouse   144 NPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWK 208
            |.:.:..:.:|.|||:|.:|:||||:|||..:||:...|.:||.:|.|||.|:||||||||.|||
  Fly   311 NGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWK 375

Mouse   209 K------DHKLPNTKGRSSSSSSCSSSAAPGQHLQPMA-KDHHTDL 247
            :      .|.|    ||:.::|..........|:...| :..|..|
  Fly   376 RVKAGLTSHGL----GRNGTTSGTKIVVPIPVHVNRFAVRSQHQQL 417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hoxd4NP_034599.2 Antp-type hexapeptide 131..136
Homeobox 155..208 CDD:278475 32/53 (60%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 31/51 (61%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.