DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hoxd3 and unpg

Sequence 1:NP_034598.2 Gene:Hoxd3 MGIID:96207 Length:433 Species:Mus musculus
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:517 Identity:118/518 (23%)
Similarity:168/518 (32%) Gaps:208/518 (40%)


Mouse     2 LFEQGQL-TLELPECTMQKAAY---YENPGLFGGYGYSKATDTYGYSTPHQPYPPPAAANSLDSD 62
            |.:.|:: |:|.|...:....:   :....|.       |..|...:||  |.||.......:::
  Fly     6 LLQNGEIGTMESPTTRLASKPFPKPFSIESLI-------ANQTPATATP--PSPPEERDQEQEAE 61

Mouse    63 YP---SSACSIQSSA------PLRAPAHKG--AE--------LNGSCMRPGTGNSQGGGGGNQPP 108
            ..   |:...:.|||      ||..|...|  |:        :.|.|..|           :.|.
  Fly    62 QEQELSARAMVASSALGLTQFPLYNPWLHGYFAQNHERLTHLIAGGCYLP-----------SSPA 115

Mouse   109 GLNSEQQP-----PQPPPPPPPT------LPPSSP------------------------------ 132
            |..:.|||     ||||||.|||      |||:.|                              
  Fly   116 GHPAAQQPQAQAQPQPPPPHPPTHALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAEL 180

Mouse   133 ----------------------------TNPG------------SGVPAKKTK------------ 145
                                        .|||            ...|||...            
  Fly   181 MNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGM 245

Mouse   146 ------GGLSASSSSSTISKQIFPWMKESRQNSKQKNSCATSGENCEDK---------------- 188
                  .|.|.|..|.|:|.:.:....:..:|....||   ..|:|.|.                
  Fly   246 DEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNS---DSEDCSDDEGAQSRHEGGGMGGKD 307

Mouse   189 -----SPPGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRM 248
                 |.....|:|.|||:||.||:|||:|||..:||....|.::|..|.|:|.|:||||||||.
  Fly   308 SQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRA 372

Mouse   249 KYKKDQKAKGILHSPAGQSPERSPPLGGAAGHVAYSGQLPPVPGLAYDAPSPPAFAKSQPNMYGL 313
            |:|: .|| |:.....|::           |..:.:..:.|:|              ...|.:.:
  Fly   373 KWKR-VKA-GLTSHGLGRN-----------GTTSGTKIVVPIP--------------VHVNRFAV 410

Mouse   314 AAYTAPLSS-CLPQQKRYPAPEFEPHPMASNGGGFASANLQGSPVYVGGNFVDSMAPTSGPV 374
            .:....|.. ||..    |.|:......|...|||  ....||        .::.:|:.|||
  Fly   411 RSQHQQLEKMCLSG----PKPDLRKKLSAEAIGGF--EKFSGS--------TNASSPSGGPV 458

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hoxd3NP_034598.2 Antp-type hexapeptide 161..166 0/5 (0%)
Homeobox 199..251 CDD:278475 30/52 (58%)
DUF4074 370..431 CDD:290032 3/6 (50%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 29/51 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.