DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hoxd10 and unpg

Sequence 1:XP_006498852.1 Gene:Hoxd10 MGIID:96202 Length:410 Species:Mus musculus
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:397 Identity:92/398 (23%)
Similarity:144/398 (36%) Gaps:121/398 (30%)


Mouse    76 SSPAANTFLVDSLISACRSDSFYSSSASMYMPPPSADMGTYGMQTCGLLPSLAKREVNHQNMGMN 140
            |.|....|.::|||:     :...::|:...||...|......|...|   .|:..|....:|:.
  Fly    24 SKPFPKPFSIESLIA-----NQTPATATPPSPPEERDQEQEAEQEQEL---SARAMVASSALGLT 80

Mouse   141 VHP-YIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTANIKEESNCCMYSDKRNKLISAEVPSYQRL 204
            ..| |.|.:..:...|     .:.:|..:           ...|.:.|.      .|..|:.|: 
  Fly    81 QFPLYNPWLHGYFAQN-----HERLTHLI-----------AGGCYLPSS------PAGHPAAQQ- 122

Mouse   205 VPESCPVENPEVPVPGYFRLSQTYATGKTQEYNNSPEGSSTVMLQLNPRGAAKPQLSAAQLQMEK 269
             |::.....|..|.|      .|:|..| |.....|....|..|..||..|.......:..::.:
  Fly   123 -PQAQAQPQPPPPHP------PTHALEK-QLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAE 179

Mouse   270 KMNE---------------SASG--------------QEPTKVSQVESPEAKG-----------G 294
            .||:               :|:|              ||||......||...|           |
  Fly   180 LMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVG 244

Mouse   295 LPEDRSC----LAEVSVS-SP-----EVQEKESKEEIKSDT------------------------ 325
            :.||..|    .:::|:: ||     |:.:..:.....||:                        
  Fly   245 MDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQ 309

Mouse   326 ---PTSNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKSVNLTDRQVKIWFQNR 387
               .:||   :|| |::|..:|..|.||||:||....||:...|.:|:.|:.|::.|||||||||
  Fly   310 GNGSSSN---SKS-RRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNR 370

Mouse   388 RMKLKKM 394
            |.|.|::
  Fly   371 RAKWKRV 377

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hoxd10XP_006498852.1 Homeobox 339..392 CDD:278475 26/53 (49%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.