DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hoxd1 and zen2

Sequence 1:NP_034597.2 Gene:Hoxd1 MGIID:96201 Length:328 Species:Mus musculus
Sequence 2:NP_476794.1 Gene:zen2 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster

Alignment Length:123 Identity:52/124 (42%)
Similarity:65/124 (52%) Gaps:28/124 (23%)


Mouse   192 ASPTSSLPAAHSTFEWMKVKRNAPKKSKLSEYGATSPPSAIRTNFSTKQLTELEKEFHFNKYLTR 256
            |:||::              ..:.:|||.|           ||.||:.||.|||:|||.||||.|
  Fly    31 AAPTAT--------------TRSSEKSKRS-----------RTAFSSLQLIELEREFHLNKYLAR 70

Mouse   257 ARRIEIANCLQLNDTQVKIWFQNRRMKQKK-REREGLLATAASVASIKLPRSETSPIK 313
            .|||||:..|.|.:.||||||||||||.|| ..|:|  |..|...||.|....:..::
  Fly    71 TRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRKG--AIGALTTSIPLSSQSSEDLQ 126

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hoxd1NP_034597.2 PRK04233 59..>105 CDD:305134
Antp-type hexapeptide 204..209 0/5 (0%)
Homeobox 233..285 CDD:278475 36/52 (69%)
zen2NP_476794.1 Homeobox 46..99 CDD:278475 37/64 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.