DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hoxd1 and unpg

Sequence 1:NP_034597.2 Gene:Hoxd1 MGIID:96201 Length:328 Species:Mus musculus
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:343 Identity:90/344 (26%)
Similarity:120/344 (35%) Gaps:89/344 (26%)


Mouse    20 GGDVLGFAPKFCRADARPVALQPAFPLGSGDGAFVSCLPLATARPTPSPPAGPA-----QSP--V 77
            ||..|..:|.     ..|.|.||.                |.|:|.|.||..|.     |.|  :
  Fly   106 GGCYLPSSPA-----GHPAAQQPQ----------------AQAQPQPPPPHPPTHALEKQLPPTL 149

Mouse    78 PQPAAPRYAPCTLEGAYERGAAPASAAEYGFLGSGPAFDFPGALGRAADEGGAHVHYATSAVFSG 142
            |.|...|:.|.....|   |.||...: |..|......|:..:|.         ||.....:.:.
  Fly   150 PHPLDTRFLPFNPAAA---GVAPTDLS-YRRLAELMNQDYVHSLS---------VHARLQHMAAA 201

Mouse   143 GGSFLLSGQVDFAAFGEPGPFPACLKEPADGHPGPFQTVSPAPGA-------CPKPASPTSSLPA 200
            |...........|...||.| |.....||..  |....:.||...       |...:....||..
  Fly   202 GRMHEDQANPGMAQLQEPTP-PQAHSSPAKS--GSHSPMEPALDVGMDEDFECSGDSCSDISLTM 263

Mouse   201 AHSTFEW-MKVKRNAP--------------------------KKSKLSEYGATSPPSAIRTNFST 238
            :...:.. |...||..                          |.|:.:...:.|.....||.|::
  Fly   264 SPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTS 328

Mouse   239 KQLTELEKEFHFNKYLTRARRIEIANCLQLNDTQVKIWFQNRRMKQKKREREGLLATAASVASIK 303
            :||.|||:|||..|||:...|.:||..|:|::.||||||||||.|.|:        ..|.:.|..
  Fly   329 EQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR--------VKAGLTSHG 385

Mouse   304 LPRSETSPIKSGRNLGSP 321
            |.|:.|:   ||..:..|
  Fly   386 LGRNGTT---SGTKIVVP 400

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hoxd1NP_034597.2 PRK04233 59..>105 CDD:305134 17/53 (32%)
Antp-type hexapeptide 204..209 1/6 (17%)
Homeobox 233..285 CDD:278475 30/52 (58%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 29/51 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.