DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb9 and zfh2

DIOPT Version :9

Sequence 1:NP_032296.2 Gene:Hoxb9 / 15417 MGIID:96190 Length:250 Species:Mus musculus
Sequence 2:NP_524623.2 Gene:zfh2 / 43795 FlyBaseID:FBgn0004607 Length:3005 Species:Drosophila melanogaster


Alignment Length:291 Identity:61/291 - (20%)
Similarity:97/291 - (33%) Gaps:78/291 - (26%)


- Green bases have known domain annotations that are detailed below.


Mouse     4 SGTLSSYYVDSIISHE---SEDAPPAKFPSGQYANPRQPGHAEHLDFPSCSFQPKAPVFGASWAP 65
            ||.:|.|..::|...:   .|...|... .||..:..|.......||   ::|.|          
  Fly  1957 SGNISDYIGNNIFFGQLGSKEQILPYSL-DGQIKSEPQDDMIGATDF---AYQTK---------- 2007

Mouse    66 LSPHASGSLPSVYHPYLQP-------QGAPAAESRYLRTWLEPAPRA---------EAAPGQGQA 114
              .|:|.|........:.|       |.|..|:.:.|......|...         |.....|.:
  Fly  2008 --QHSSFSFLKQQQDLVDPPEQCLTNQNADTAQDQSLLAGSSLASNCQSQQQINIFETKSESGSS 2070

Mouse   115 AVKAEP----------LLGAPGELLKQGTPEYSLETSAGREAVLSNQRAGYGDNK---------- 159
            .|.:.|          :.|:..:||.|               .|.|..:..|..|          
  Fly  2071 DVLSRPPSPNSGAAGNVYGSMNDLLNQ---------------QLENMGSNMGPPKKMQIVGKTFE 2120

Mouse   160 ------ICEGSEDKERPDQTNPSANWLHARSSRKK--RCPYTKYQTLELEKEFLFNMYLTRDRRH 216
                  :..||...:....::.|::...:.|..|:  |..:|.||...|::.|..|.|.......
  Fly  2121 KNVAPMVTSGSVSTQFESNSSNSSSSSSSTSGGKRANRTRFTDYQIKVLQEFFENNSYPKDSDLE 2185

Mouse   217 EVARLLNLSERQVKIWFQNRRMKMKKMNKEQ 247
            .:::||.||.|.:.:||||.|.|.:|:.:.|
  Fly  2186 YLSKLLLLSPRVIVVWFQNARQKQRKIYENQ 2216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb9NP_032296.2 Hox9_act 1..172 CDD:398350 37/212 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..48 6/26 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..182 3/21 (14%)
Homeobox 188..242 CDD:395001 19/55 (35%)
zfh2NP_524623.2 C2H2 Zn finger 561..581 CDD:275368
C2H2 Zn finger 616..633 CDD:275368
C2H2 Zn finger 1515..1542 CDD:275371
C2H2 Zn finger 1543..1564 CDD:275371
HOX 1797..1853 CDD:197696
Homeobox 2158..2210 CDD:278475 19/51 (37%)
Homeobox 2764..2816 CDD:278475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.