DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb9 and lbe

DIOPT Version :9

Sequence 1:NP_032296.2 Gene:Hoxb9 / 15417 MGIID:96190 Length:250 Species:Mus musculus
Sequence 2:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster


Alignment Length:312 Identity:85/312 - (27%)
Similarity:114/312 - (36%) Gaps:83/312 - (26%)


- Green bases have known domain annotations that are detailed below.


Mouse     2 SISGTLSSYYVDSIISHESED--------------APPAK---FPSGQYANPR------QPGHAE 43
            :|.| :.|:.:..|:.|..:.              ||||.   .|||....||      .|..|.
  Fly   127 AIEG-VKSFSIADILGHSEKQREESVSPPPNANLLAPPASRPIAPSGGLLQPRTEPLDVHPAAAA 190

Mouse    44 HLDFPSCS--------FQPKAPVFGASWAPLSP----HASGSLPSVYHPYLQPQGAPAAESRYLR 96
            .:..||..        ..|..||     .|..|    |....|...||..||...  .|:::.||
  Fly   191 AMLLPSGQIVRPWDHLLGPTMPV-----RPFIPSALLHYEQRLALDYHRQLQEHF--NAQAQLLR 248

Mouse    97 -TWLEPA------------PRAEAAPGQGQA-----AVKAEPLLGAPGELLKQGTPEYSLETSAG 143
             ..:.||            .|:.::.|..:.     |.|.|.|....|....|........|.:|
  Fly   249 HMGMNPAIIASEDGSSERSQRSSSSNGSTECCSPRQAEKLEKLTTQEGSEEAQKKKSEEQPTGSG 313

Mouse   144 REAVLSNQRAGYGD----------NKICEGSEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTL 198
            :    ||     ||          .|..:.|:||...|   ..:|....:..||.|..:|.:|..
  Fly   314 K----SN-----GDTPLDALFQMTTKDFDESQDKSHLD---IFSNRPQPKKKRKSRTAFTNHQIF 366

Mouse   199 ELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQGKE 250
            ||||.||:..||:...|.|:|..|.||..||..||||||.|.|:..:|..|:
  Fly   367 ELEKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRRAKQKRDIEELKKD 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb9NP_032296.2 Hox9_act 1..172 CDD:398350 52/232 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..48 11/49 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..182 5/21 (24%)
Homeobox 188..242 CDD:395001 26/53 (49%)
lbeNP_524435.2 Homeobox 356..410 CDD:395001 26/53 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.