DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb9 and lbl

DIOPT Version :9

Sequence 1:NP_032296.2 Gene:Hoxb9 / 15417 MGIID:96190 Length:250 Species:Mus musculus
Sequence 2:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster


Alignment Length:287 Identity:68/287 - (23%)
Similarity:106/287 - (36%) Gaps:62/287 - (21%)


- Green bases have known domain annotations that are detailed below.


Mouse    16 ISHESEDAPPAKFPSGQYANPRQPGH--------AEHLDFPSCSFQPKAP---VFGASWAPLSPH 69
            :.|:.:.:.|.:..|...|:....||        .|.:..|:......||   :......||.|:
  Fly    40 LEHDRQKSSPVRVKSFSIADILGRGHEEDRVEKKPERIAIPNALPGVPAPLALINERLQIPLVPN 104

Mouse    70 ASGSLPSVYHPYLQPQGAPAAESR----YLRTWLEPAPRAEAAPGQGQAAVKAEPLLGAPGELLK 130
            ...  |:..|.:|.|....:.|.|    |.|...|..        |.||.:..:..|.......:
  Fly   105 CPP--PAALHTFLSPALLHSYEQRLAWDYQRQLQEHF--------QAQAQLLRQMTLNPAIIASE 159

Mouse   131 QGTPEYSLETSAGR---------EAVLSNQRA---------------------GYGDNKI----- 160
            .|:.|.|..:|:..         :|....:|:                     ..||..:     
  Fly   160 DGSSERSQRSSSSNGSTECCSPTQAEKVEKRSQEDRMEVPKKSPEEQPKGASKSSGDTPLDALFQ 224

Mouse   161 --CEGSEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLN 223
              .:..::::.|...|..|...:.:..||.|..:|..|..||||.||:..||:...|.|:|..|.
  Fly   225 LSTKNFDEEQDPATLNIFATRSNPKKKRKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIAGGLG 289

Mouse   224 LSERQVKIWFQNRRMKMKKMNKEQGKE 250
            ||..||..||||||.|:|:..:|..|:
  Fly   290 LSNAQVITWFQNRRAKLKRDMEELKKD 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb9NP_032296.2 Hox9_act 1..172 CDD:398350 35/207 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..48 6/34 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..182 3/28 (11%)
Homeobox 188..242 CDD:395001 26/53 (49%)
lblNP_001262805.1 COG5576 206..332 CDD:227863 36/111 (32%)
Homeobox 254..307 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.