powered by:
Protein Alignment Hoxb9 and Ubx
DIOPT Version :9
| Sequence 1: | NP_032296.2 |
Gene: | Hoxb9 / 15417 |
MGIID: | 96190 |
Length: | 250 |
Species: | Mus musculus |
| Sequence 2: | NP_536752.1 |
Gene: | Ubx / 42034 |
FlyBaseID: | FBgn0003944 |
Length: | 389 |
Species: | Drosophila melanogaster |
| Alignment Length: | 66 |
Identity: | 42/66 - (63%) |
| Similarity: | 50/66 - (75%) |
Gaps: | 1/66 - (1%) |
- Green bases have known domain annotations that are detailed below.
|
Mouse 178 NWLHARSSRKK-RCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMK 241
:||.....|:: |..||:||||||||||..|.||||.||.|:|..|.|:|||:||||||||||:|
Fly 287 DWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLK 351
Mouse 242 K 242
|
Fly 352 K 352
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000007 |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.