DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb9 and bcd

DIOPT Version :10

Sequence 1:NP_032296.2 Gene:Hoxb9 / 15417 MGIID:96190 Length:250 Species:Mus musculus
Sequence 2:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster


Alignment Length:175 Identity:48/175 - (27%)
Similarity:70/175 - (40%) Gaps:27/175 - (15%)


- Green bases have known domain annotations that are detailed below.


Mouse    78 YHPYLQPQGAPAAESRYLRTWLEPAPRAEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSA 142
            :||.......|...|       .|.|.:...|......::..|....|.:||        .:...
  Fly    12 HHPLPHTHTHPHPHS-------HPHPHSHPHPHHQHPQLQLPPQFRNPFDLL--------FDERT 61

Mouse   143 GREAVLSNQRAGYGDNKICEGS--EDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEKEFL 205
            |  |:..|....|..|::.:..  ..:|.||.       |..|..|:.|..:|..|..|||:.||
  Fly    62 G--AINYNYIRPYLPNQMPKPDVFPSEELPDS-------LVMRRPRRTRTTFTSSQIAELEQHFL 117

Mouse   206 FNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQGKE 250
            ...|||..|..:::..|.|...||||||:||| :..|:..:|.|:
  Fly   118 QGRYLTAPRLADLSAKLALGTAQVKIWFKNRR-RRHKIQSDQHKD 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb9NP_032296.2 Hox9_act 1..172 CDD:461369 18/95 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..48
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..182 4/23 (17%)
Homeodomain 186..242 CDD:459649 24/55 (44%)
bcdNP_788587.1 Homeodomain 106..153 CDD:459649 21/47 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.