DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb9 and zen

DIOPT Version :10

Sequence 1:NP_032296.2 Gene:Hoxb9 / 15417 MGIID:96190 Length:250 Species:Mus musculus
Sequence 2:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster


Alignment Length:79 Identity:41/79 - (51%)
Similarity:50/79 - (63%) Gaps:3/79 - (3%)


- Green bases have known domain annotations that are detailed below.


Mouse   164 SEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQ 228
            |.|:..|.|.|..:..:..:.|   |..:|..|.:|||.||..||||.|.||.|:|:.|:|.|||
  Fly    72 SSDENLPSQPNHDSQRVKLKRS---RTAFTSVQLVELENEFKSNMYLYRTRRIEIAQRLSLCERQ 133

Mouse   229 VKIWFQNRRMKMKK 242
            |||||||||||.||
  Fly   134 VKIWFQNRRMKFKK 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb9NP_032296.2 Hox9_act 1..172 CDD:461369 3/7 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..48
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..182 5/17 (29%)
Homeodomain 186..242 CDD:459649 33/55 (60%)
zenNP_476793.1 Homeodomain 91..147 CDD:459649 34/58 (59%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.