DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb9 and zen2

DIOPT Version :9

Sequence 1:NP_032296.2 Gene:Hoxb9 / 15417 MGIID:96190 Length:250 Species:Mus musculus
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:74 Identity:36/74 - (48%)
Similarity:50/74 - (67%) Gaps:0/74 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse   175 PSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMK 239
            |:|....:..|::.|..::..|.:|||:||..|.||.|.||.|:::.|.|:||||||||||||||
  Fly    33 PTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMK 97

Mouse   240 MKKMNKEQG 248
            :||....:|
  Fly    98 LKKSTNRKG 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb9NP_032296.2 Hox9_act 1..172 CDD:398350
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..48
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..182 2/6 (33%)
Homeobox 188..242 CDD:395001 30/53 (57%)
zen2NP_476794.1 Homeobox 46..99 CDD:278475 30/52 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.