DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb9 and exex

DIOPT Version :9

Sequence 1:NP_032296.2 Gene:Hoxb9 / 15417 MGIID:96190 Length:250 Species:Mus musculus
Sequence 2:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster


Alignment Length:250 Identity:70/250 - (28%)
Similarity:86/250 - (34%) Gaps:81/250 - (32%)


- Green bases have known domain annotations that are detailed below.


Mouse    17 SHESEDAPPAKFPSGQYANPRQPGHAEHLDFPSCSFQPKAPVFGASWAPLSPHA----------S 71
            ||.|  :||..........|....|.:||......|..:..      .|:.||:          :
  Fly   314 SHRS--SPPISPGCEDQQQPHGALHPQHLSMRMSDFHDEFK------KPIPPHSPIRPQDFPLYA 370

Mouse    72 GSLP--------SVYHPYLQPQGAPAAESRYLRTWLEPAPRA-EAAPGQGQAAVKAEPLLGAPGE 127
            |..|        |.:|..|.|.|.|.           |.|.. ...|.|.|....|.      ..
  Fly   371 GGHPYQLLAQGGSAFHRPLDPSGKPI-----------PIPMGHNFMPSQLQFEFLAR------AG 418

Mouse   128 LLKQGTPEYSLETSAGREAVLSNQRAGYGDNKICEGSEDKERPDQTNPSANWLHARSSRKKRCPY 192
            :|....||.                |.|..:.|                     ...:|:.|..:
  Fly   419 MLHHRIPEL----------------AAYPHHAI---------------------LGKTRRPRTAF 446

Mouse   193 TKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQ 247
            |..|.|||||:|..|.||:|.:|.|||..|.|||.||||||||||||.|:..|.|
  Fly   447 TSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSKKAQ 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb9NP_032296.2 Hox9_act 1..172 CDD:398350 33/173 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..48 6/26 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..182 1/21 (5%)
Homeobox 188..242 CDD:395001 33/53 (62%)
exexNP_648164.1 Homeobox 442..495 CDD:278475 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.