DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb9 and Vsx2

DIOPT Version :9

Sequence 1:NP_032296.2 Gene:Hoxb9 / 15417 MGIID:96190 Length:250 Species:Mus musculus
Sequence 2:NP_001284897.1 Gene:Vsx2 / 31469 FlyBaseID:FBgn0263512 Length:645 Species:Drosophila melanogaster


Alignment Length:217 Identity:52/217 - (23%)
Similarity:74/217 - (34%) Gaps:64/217 - (29%)


- Green bases have known domain annotations that are detailed below.


Mouse    32 QYANPRQPGHAEHLDFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYLQPQGAPAAESRYLR 96
            |:.:...|.|..|        .|...|.|....|...|.....|  :||.|..||.|..:|    
  Fly   141 QHQHQHHPHHHPH--------HPHGAVGGPPPPPPMQHHHPHHP--HHPLLHAQGFPQLKS---- 191

Mouse    97 TWLEPAPRAEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRAGYGDNKIC 161
                      .|.|.|..         .||.|..:   ::.:|:..|         .|.|.|   
  Fly   192 ----------FAAGAGTC---------LPGSLAPK---DFGMESLNG---------FGVGPN--- 222

Mouse   162 EGSEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSE 226
              |:.|:              :..|..|..:|.||..:||:.|....|.....|..::....|.|
  Fly   223 --SKKKK--------------KKRRHSRTIFTSYQLEKLEEAFKEAHYPDVYAREMLSLKTELPE 271

Mouse   227 RQVKIWFQNRRMKMKKMNKEQG 248
            .::::||||||.|.:|..|..|
  Fly   272 DRIQVWFQNRRAKWRKTEKVWG 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb9NP_032296.2 Hox9_act 1..172 CDD:398350 30/139 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..48 4/15 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..182 2/21 (10%)
Homeobox 188..242 CDD:395001 18/53 (34%)
Vsx2NP_001284897.1 Homeobox 233..286 CDD:278475 18/52 (35%)
OAR 556..570 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.