DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hoxb6 and Antp

Sequence 1:XP_006532355.1 Gene:Hoxb6 MGIID:96187 Length:309 Species:Mus musculus
Sequence 2:NP_996167.1 Gene:Antp FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster

Alignment Length:313 Identity:107/314 (34%)
Similarity:137/314 (44%) Gaps:83/314 (26%)


Mouse    36 NAPLSLPPHPFESGGGQNPPSSAKARRSDYK------------TQQIINPAEQQR---------- 78
            |..|.:|....:.   |..||..:.::...:            |||:.:|.:||:          
  Fly   103 NGQLGVPQQQQQQ---QQQPSQNQQQQQAQQAPQQLQQQLPQVTQQVTHPQQQQQQPVVYASCKL 164

Mouse    79 ----------PR--APPL--PMSSYFVNS--TFPVTLASGQESFLGQLPLYSSGYADPLRHYPAP 127
                      |.  :|||  .||.:.:|:  |.|..:...|    .||.....|..|....:...
  Fly   165 QAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHHMGHPQ----AQLGYTDVGVPDVTEVHQNH 225

Mouse   128 YGPGPGQDKGFAASSYYPPAGGGY-GRAAPCDYGPAPAFYREKDAACALSGADEPPPFHPEPRKS 191
            :..|..|.:........||.|..: |:..|..:...|             |...||..:|..:.|
  Fly   226 HNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHP-------------GQHTPPSQNPNSQSS 277

Mouse   192 DCAQDKSVFGETEEQKCSTPVYPWMQRMNSCNSSSFG--PSGRRGRQTYTRYQTLELEKEFHYNR 254
            .               ..:|:||||:       |.||  ...:|||||||||||||||||||:||
  Fly   278 G---------------MPSPLYPWMR-------SQFGKCQERKRGRQTYTRYQTLELEKEFHFNR 320

Mouse   255 YLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKESKLLSASQLSAEEEEEKP 307
            |||||||||||||||||||||||||||||||||||:|.........|.:|..|
  Fly   321 YLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGEGDEITP 373

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hoxb6XP_006532355.1 Homeobox 235..287 CDD:278475 51/52 (98%)
AntpNP_996167.1 Homeobox 301..353 CDD:278475 51/52 (98%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45659
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2625
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.