DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb5 and zen2

DIOPT Version :10

Sequence 1:NP_032294.2 Gene:Hoxb5 / 15413 MGIID:96186 Length:269 Species:Mus musculus
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:62 Identity:39/62 - (62%)
Similarity:48/62 - (77%) Gaps:0/62 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse   195 KRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLK 256
            ||:|||::..|.:|||:|||.|:||.|.|||||:..|.|:|||:||||||||||.||....|
  Fly    44 KRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRK 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb5NP_032294.2 PRK07003 <67..>171 CDD:235906
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..173
Antp-type hexapeptide 176..181
Homeodomain 195..251 CDD:459649 36/55 (65%)
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 36/55 (65%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.