DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hoxb4 and Antp

Sequence 1:NP_034589.3 Gene:Hoxb4 MGIID:96185 Length:250 Species:Mus musculus
Sequence 2:NP_996167.1 Gene:Antp FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster

Alignment Length:239 Identity:91/240 (38%)
Similarity:108/240 (45%) Gaps:78/240 (33%)


Mouse    12 YVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESGFQPEAAFGRRAPCTVQRYAACRDPGPPPP 76
            |.|...|...|..|     :.|:.|.|    :::||.                            
  Fly   210 YTDVGVPDVTEVHQ-----NHHNMGMY----QQQSGV---------------------------- 237

Mouse    77 PPPPPPPPPPGL--SPRAPVQPTAGALLPEPGQRSEAVSSSPPPPPCAQNPLHPSPSHSACKEPV 139
              ||...||.|:  ..:.|.|...|    .|||.     :.|...|.:|:...|||         
  Fly   238 --PPVGAPPQGMMHQGQGPPQMHQG----HPGQH-----TPPSQNPNSQSSGMPSP--------- 282

Mouse   140 VYPWMRKVHVSTVNPNYAGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHALCLSERQ 204
            :|||||......       .|.||.|..|||.|.||||||||:|||||||||:||||||||:|||
  Fly   283 LYPWMRSQFGKC-------QERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQ 340

Mouse   205 IKIWFQNRRMKWKKDHKLPNTKIRSGGTAGAAG-----GPPGRP 243
            ||||||||||||||::|   ||    |..|:.|     .||..|
  Fly   341 IKIWFQNRRMKWKKENK---TK----GEPGSGGEGDEITPPNSP 377

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hoxb4NP_034589.3 Antp-type hexapeptide 140..145 4/5 (80%)
Homeobox 164..217 CDD:306543 45/53 (85%)
AntpNP_996167.1 Homeobox 301..353 CDD:278475 45/52 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.