DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hoxb1 and Antp

Sequence 1:XP_006532343.1 Gene:Hoxb1 MGIID:96182 Length:330 Species:Mus musculus
Sequence 2:NP_996167.1 Gene:Antp FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster

Alignment Length:403 Identity:102/404 (25%)
Similarity:123/404 (30%) Gaps:176/404 (44%)


Mouse     1 MDYNRMSSFLEYPLCN-------RGPSAYSAPTSFPPCSAPAVDSYAGESRYGGGLPSSALQQNS 58
            |.|.|...:...|..|       :....||.|.|      |:       |:.||.:|.:......
  Fly    55 MPYPRFPPYDRMPYYNGQGMDQQQQHQVYSRPDS------PS-------SQVGGVMPQAQTNGQL 106

Mouse    59 GYP------------------VQQPPSSLGVSFP------------SPAPSGYAPAACNPSYGPS 93
            |.|                  .||.|..|....|            ...|..||......:.|..
  Fly   107 GVPQQQQQQQQQPSQNQQQQQAQQAPQQLQQQLPQVTQQVTHPQQQQQQPVVYASCKLQAAVGGL 171

Mouse    94 QYYSVGQS-----EGDGSYF-----------HPSSYGAQLG----GLPD---------------- 122
            .....|.|     :..|.:.           ||.   ||||    |:||                
  Fly   172 GMVPEGGSPPLVDQMSGHHMNAQMTLPHHMGHPQ---AQLGYTDVGVPDVTEVHQNHHNMGMYQQ 233

Mouse   123 SYGAGGVGSGP-------YPPPQ----------PPYGTEQTATFASAYDLLSEDKESPCSSEPST 170
            ..|...||:.|       ..|||          ||                |::..|..|..||.
  Fly   234 QSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPP----------------SQNPNSQSSGMPSP 282

Mouse   171 LTPRTFDWMKVKRNPPKTGRAQRSHFLSLARAYTEGPEPGLHSFLQLLLLAAKVSELGLGAPGGL 235
            |.|    ||             ||.|                         .|..|...|     
  Fly   283 LYP----WM-------------RSQF-------------------------GKCQERKRG----- 300

Mouse   236 RTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKIWFQNRRMKQKKREREGGRMPAG 300
            |..:|..|..|||||||||:||:|.||:|||..|.|.|.|:||||||||||.||..:..|...:|
  Fly   301 RQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSG 365

Mouse   301 -------PPGCPK 306
                   ||..|:
  Fly   366 GEGDEITPPNSPQ 378

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hoxb1XP_006532343.1 Homeobox 236..288 CDD:278475 34/52 (65%)
AntpNP_996167.1 Homeobox 301..353 CDD:278475 34/52 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.