powered by:
Protein Alignment Hoxb1 and zen2
DIOPT Version :9
| Sequence 1: | XP_006532343.1 |
Gene: | Hoxb1 / 15407 |
MGIID: | 96182 |
Length: | 330 |
Species: | Mus musculus |
| Sequence 2: | NP_476794.1 |
Gene: | zen2 / 40827 |
FlyBaseID: | FBgn0004054 |
Length: | 252 |
Species: | Drosophila melanogaster |
| Alignment Length: | 101 |
Identity: | 45/101 - (44%) |
| Similarity: | 55/101 - (54%) |
Gaps: | 11/101 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Mouse 236 RTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKIWFQNRRMKQKKREREGGRMPAG 300
||.|::.||.|||:|||.||||:|.||:||:..|.|.|.||||||||||||.||.....|.:.|.
Fly 47 RTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRKGAIGAL 111
Mouse 301 PPGCPKEAAGDASDQS-----------ACTSPEASP 325
....|..:......|. |.|:.|.:|
Fly 112 TTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAP 147
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0489 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
1 |
1.000 |
- |
- |
|
X14 |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.