DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hoxa3 and Antp

Sequence 1:NP_034582.1 Gene:Hoxa3 MGIID:96175 Length:443 Species:Mus musculus
Sequence 2:NP_996167.1 Gene:Antp FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster

Alignment Length:270 Identity:91/271 (34%)
Similarity:113/271 (42%) Gaps:83/271 (31%)


Mouse    14 GGYP--YQAANGFAYNASQQ-PY---APSAALG-TD-GVEYHRPACSLQSPASAGGHPKTHELSE 70
            ||.|  ....:|...||... |:   .|.|.|| || ||           |.....|...|.:  
  Fly   177 GGSPPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGV-----------PDVTEVHQNHHNM-- 228

Mouse    71 ACLRTLSGPPSQPPGLGEPPLPPPPPQAAPP--APQPPQPPPQPPAPTPAAPPPPSSVSPPQSAN 133
                   |...|..|:        ||..|||  .....|.|||.....|....|||. :|...::
  Fly   229 -------GMYQQQSGV--------PPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQ-NPNSQSS 277

Mouse   134 SNPTPASTAKSPLLNSPTVGKQIFPWMKESRQNTKQKTSGSSSGESCAGDKSPPGQASSKRARTA 198
            ..|:|                 ::|||:......:::                      ||.|..
  Fly   278 GMPSP-----------------LYPWMRSQFGKCQER----------------------KRGRQT 303

Mouse   199 YTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKGKGMLTSSGGQ 263
            ||..|.:||||||||||||.|.||:|:|:.|.||||||||||||||||:||:.|.||. ..|||:
  Fly   304 YTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGE-PGSGGE 367

Mouse   264 ----SPSRSP 269
                :|..||
  Fly   368 GDEITPPNSP 377

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hoxa3NP_034582.1 Antp-type hexapeptide 156..161 3/5 (60%)
COG5576 <182..309 CDD:227863 51/93 (55%)
Homeobox 196..248 CDD:278475 38/52 (73%)
DUF4074 378..441 CDD:290032
AntpNP_996167.1 Homeobox 301..353 CDD:278475 38/52 (73%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.