DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hoxa3 and unpg

Sequence 1:NP_034582.1 Gene:Hoxa3 MGIID:96175 Length:443 Species:Mus musculus
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:452 Identity:108/453 (24%)
Similarity:150/453 (33%) Gaps:168/453 (37%)


Mouse    29 SQQPYAPSAALGTDGVEYHRPACSLQSPASAGGHPKTHELSEACLRTLSGPPSQPPGLGEPPLPP 93
            |.:....|:|||......:.|  .|....:......||.::..|..     ||.|  .|.|....
  Fly    67 SARAMVASSALGLTQFPLYNP--WLHGYFAQNHERLTHLIAGGCYL-----PSSP--AGHPAAQQ 122

Mouse    94 PPPQAAPPAPQPPQPPPQPPAPTPAAPPPPSSVSP---------PQSANSNPTPASTAK-SPLLN 148
            |..||     ||..|||.||........||:...|         |.:|...||..|..: :.|:|
  Fly   123 PQAQA-----QPQPPPPHPPTHALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMN 182

Mouse   149 SPTV---------------GK----QIFPWMKESRQNTKQKT------SGS-------------- 174
            ...|               |:    |..|.|.:.::.|..:.      |||              
  Fly   183 QDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDE 247

Mouse   175 ---SSGESCA----------------------------------------------GDKSPPGQA 190
               .||:||:                                              |.|...|..
  Fly   248 DFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNG 312

Mouse   191 S-----SKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKD 250
            |     |:|.|||:||.||:|||:|||..:||....|.::|..|.|:|.|:||||||||.|:|:.
  Fly   313 SSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRV 377

Mouse   251 QKGKGMLTSSG-GQSPSRS------PVPPGAGGY-LNSMHSLVNSVPYEPQSPPPFSKPPQGAYG 307
            :.|   |||.| |::.:.|      |:|.....: :.|.|..:..:                   
  Fly   378 KAG---LTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQLEKM------------------- 420

Mouse   308 LPPASYPAPLPSCAPPPPPQKRYTAAGSGAGGTPDYDPHAHGLQGNGSYGTPHLQGSPVFVG 369
                        |...|.|..|...:....||...:         :||.......|.||.:|
  Fly   421 ------------CLSGPKPDLRKKLSAEAIGGFEKF---------SGSTNASSPSGGPVGLG 461

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hoxa3NP_034582.1 Antp-type hexapeptide 156..161 2/5 (40%)
COG5576 <182..309 CDD:227863 48/140 (34%)
Homeobox 196..248 CDD:278475 30/52 (58%)
DUF4074 378..441 CDD:290032
unpgNP_477146.1 Homeobox 324..375 CDD:278475 29/51 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.