DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hoxa2 and unpg

Sequence 1:NP_034581.1 Gene:Hoxa2 MGIID:96174 Length:372 Species:Mus musculus
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:386 Identity:89/387 (23%)
Similarity:130/387 (34%) Gaps:140/387 (36%)


Mouse    16 PSLAECLTS----FPPVADTFQSSSIKTSTLSHSTLIPPPFEQTIPSLNPGSHPRHGAGVG---- 72
            |:|...|.:    |.|.|     :.:..:.||:..|.....:..:.||:..:..:|.|..|    
  Fly   147 PTLPHPLDTRFLPFNPAA-----AGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHE 206

Mouse    73 --GRP------KSSPAGSRGSPVPAGALQPPEYPWMKEKKAAKKTALPPAAASTGPAC------- 122
              ..|      :.:|..:..||..:|:..|.|        .|....:......:|.:|       
  Fly   207 DQANPGMAQLQEPTPPQAHSSPAKSGSHSPME--------PALDVGMDEDFECSGDSCSDISLTM 263

Mouse   123 ---------------------------------------LGHKESLEIADGSGGGSRRLRTAYTN 148
                                                   :|.|:|......|...|||.|||:|:
  Fly   264 SPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTS 328

Mouse   149 TQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQCKENQNSEGKFKNL 213
            .||||||:|||..|||....|.:||..|.|:|.|||:||||||.|.||   .|....|.|     
  Fly   329 EQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR---VKAGLTSHG----- 385

Mouse   214 EDSDKVEEDEEEKSLFEQALSVSGALLEREGYTFQQNALSQQQAPNGHNGDSQTFPVSPLTSNEK 278
                                      |.|.|.|               :|.....|: |:..|..
  Fly   386 --------------------------LGRNGTT---------------SGTKIVVPI-PVHVNRF 408

Mouse   279 NLKHFQHQSPTVPNCLSTMGQNCGAGLNNDSPEAIEVPSLQDFNVFSTDSCLQLSDALSPS 339
            .::. |||.         :.:.|.:|...|..:.:...::..|..||..     ::|.|||
  Fly   409 AVRS-QHQQ---------LEKMCLSGPKPDLRKKLSAEAIGGFEKFSGS-----TNASSPS 454

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hoxa2NP_034581.1 Antp-type hexapeptide 96..101 1/5 (20%)
Homeobox 143..195 CDD:278475 32/52 (62%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.