DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SLC36A2 and CG32081

Sequence 1:NP_861441.2 Gene:SLC36A2 HGNCID:18762 Length:483 Species:Homo sapiens
Sequence 2:NP_729646.1 Gene:CG32081 FlyBaseID:FBgn0052081 Length:471 Species:Drosophila melanogaster

Alignment Length:428 Identity:125/429 (29%)
Similarity:206/429 (48%) Gaps:44/429 (10%)


Human    59 ALIHLVKGNMGTGILGLPLAVKNAGILMGPLSLLVMGFIACHCMHILVKCAQRFCKRLNKPFMDY 123
            |...|:|..:|||::.:||:...|||:.|.:.|:.:.|:..|.|.:|:.|.....:|:...:..|
  Fly    24 AFFSLLKCVVGTGVMAIPLSFNYAGIVTGIILLVSVCFMLIHGMQMLIICMIECSRRMQIGYATY 88

Human   124 GDTVMHGLEANPNAWLQNHAHWGRHIVSFFLIITQLGFCCVYIVFLADNLKQVVEAVNSTTNNCY 188
            ...:::..:..|. :.:..:..||:||...|..:|.|.|.||.||:|..|||:|:          
  Fly    89 PVAMVYSFDQGPR-FFKYISKAGRYIVDGVLAFSQFGVCVVYNVFVAATLKQLVD---------- 142

Human   189 SNETVILTPTMDSRLYMLSFLPFLVLLVLIRNLRILTIFSMLANISMLVSLVIIIQYITQEIPD- 252
                 ......|.|:|:......|:....||.|:.|..|::||:|.:.....:::.|:..::|. 
  Fly   143 -----FYWVVADLRIYIAVIALCLIPPFQIRKLKYLVPFNILASILIYTGFSLMMYYLFVDLPPI 202

Human   253 PSRLPLVASWKTYPLFFGTAIFSFESIGVVLPLENKMKNARHFP---AILSLGMSIVTSLYIGMA 314
            ..|..|.......|||||.|:||..|:||:|.:|..|...||:.   .||...:.:|...|:...
  Fly   203 TERNILFGRIDKIPLFFGIALFSITSVGVMLAVEATMAKPRHYLGWFGILDRAILLVIISYVTFG 267

Human   315 ALGYLRFGDDIKASISLNLP-NCWLYQSVKLLYIAGILCTYALQFYVPAEII----------IPF 368
            .:||.|:||:...|||||:| :..|.|..|....|.|..||.|..:|..:||          :|.
  Fly   268 LMGYWRYGDETAGSISLNIPTDEVLSQVAKGFIAAAIFLTYPLAGFVIIDIIMNHFWNKNGDLPN 332

Human   369 AISRVSTRWALPLDLSIRLVMVCLTCLLAILIPRLDLVISLVGSVSGTALALIIPPLLEVTTF-- 431
            |..:.|.         :|...|.|.|:.||:.|.|..::||||:::.:.|.|:.|.|:|:..:  
  Fly   333 AALKESI---------LRACTVVLICITAIIAPNLGPLLSLVGALTISLLNLVFPALIEICLYYP 388

Human   432 --YSEGMSPLTIFKDALISILGFVGFVVGTYQALDELL 467
              |:.|.....:.||....|:|.:..|.||..::.:::
  Fly   389 PEYNYGKLKWVLVKDIFYVIVGILILVQGTVFSIKDMI 426

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC36A2NP_861441.2 SLC5-6-like_sbd 52..463 CDD:320982 125/423 (30%)
CG32081NP_729646.1 SLC5-6-like_sbd 17..422 CDD:294310 125/423 (30%)
SdaC 20..415 CDD:223884 122/416 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C95765919
eggNOG 1 0.900 E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D284074at33208
OrthoFinder 1 1.000 FOG0000215
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22950
Phylome 1 0.910 0.889 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.