DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mnx1 and zen2

DIOPT Version :10

Sequence 1:NP_064328.2 Gene:Mnx1 / 15285 MGIID:109160 Length:404 Species:Mus musculus
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:86 Identity:42/86 - (48%)
Similarity:56/86 - (65%) Gaps:13/86 - (15%)


- Green bases have known domain annotations that are detailed below.


Mouse   240 KCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSKKAK- 303
            |.:|.||||:|.||:|||.:|.|||||:|.:|.|::..|.|||.||||||||||||.|:|...| 
  Fly    42 KSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRKG 106

Mouse   304 ------------EQAAQEAEK 312
                        .|::::.:|
  Fly   107 AIGALTTSIPLSSQSSEDLQK 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mnx1NP_064328.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..80
Homeodomain 242..298 CDD:459649 36/55 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 299..404 4/27 (15%)
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 36/55 (65%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.