DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mnx1 and zen2

Sequence 1:NP_064328.2 Gene:Mnx1 MGIID:109160 Length:404 Species:Mus musculus
Sequence 2:NP_476794.1 Gene:zen2 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster

Alignment Length:86 Identity:42/87 (48%)
Similarity:56/87 (64%) Gaps:13/87 (15%)


Mouse   240 KCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSKKAK- 303
            |.:|.||||:|.||:|||.:|.|||||:|.:|.|::..|.|||.||||||||||||.|:|...| 
  Fly    42 KSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRKG 106

Mouse   304 ------------EQAAQEAEK 312
                        .|::::.:|
  Fly   107 AIGALTTSIPLSSQSSEDLQK 127

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mnx1NP_064328.2 Homeobox 244..297 CDD:278475 35/53 (66%)
zen2NP_476794.1 Homeobox 46..99 CDD:278475 35/53 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.