DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hgs and Hrs

DIOPT Version :8

Sequence 1:XP_006532333.2 Gene:Hgs / 15239 MGIID:104681 Length:805 Species:Mus musculus
Sequence 2:NP_525099.3 Gene:Hrs / 33458 FlyBaseID:FBgn0031450 Length:760 Species:Drosophila melanogaster

Alignment Length:856 Identity:351/857 (41%)
Similarity:463/857 (54%) Gaps:157/857 (18%)


Mouse     7 TFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESV 71
            :|::.|:.|||.|.||.||.|||.|||.|.|.|...|.|..:||||:|..|||.:.|:|.|:||:
  Fly     5 SFDKNLENATSHLRLEPDWPSILLICDEINQKDVTPKNAFAAIKKKMNSPNPHSSCYSLLVLESI 69

Mouse    72 VKNCGQTVHDEVANKQTMEELKELLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMK 136
            |||||..||:||..|:..|.....|:.....|||.|:|.|:|.||:|||:..||:.::||..|:|
  Fly    70 VKNCGAPVHEEVFTKENCEMFSSFLESTPHENVRQKMLELVQTWAYAFRSSDKYQAIKDTMTILK 134

Mouse   137 VEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVVTRKHHCRACGQIFCGKCSSKYSTIP 201
            .:||.|||.:|:||||.|:.||:|.|...||||||:|....||||||.|||:|||:|::|...:|
  Fly   135 AKGHTFPEL
READAMFTADTAPNWADGRVCHRCRVEFTFTNRKHHCRNCGQVFCGQCTAKQCPLP 199

Mouse   202 KFGIEKEVRVCEPCYEQLNKKAEGKAS-------STTELPPEYLTSPLSQQSQLPPKRDETALQE 259
            |:|||||||||:.|:..|.:...|...       :.:|||.|||.|.|:||.|.|.::.|..|:|
  Fly   200 KYGIEKEVRVCDGCFAAL
QRPTSGSGGAKSGPRPADSELPAEYLNSTLAQQVQTPARKTEQELKE 264

Mouse   260 EEELQLALALSQSEAEEKERMRQKTTYTAHPKAEPTPLASSAPPAGSLYSSPVTQCLSPQNSSAP 324
            ||||||||||||||||:::...|.....|:...:.:| :..|||....|..      .|:     
  Fly   265 EEELQLALALSQSEAEQQKPKLQSLPPAAYRMQQRSP-SPEAPPEPKEYHQ------QPE----- 317

Mouse   325 LAEDIDPELARYLNRNYWE-KKQEEARKSPTPSAPVPLTEPAAQPGEGHTAPNSMAEAPLPETDS 388
              |..:||||:||||:||| :|..|:....:||||.|: .|..||                    
  Fly   318 --EATNPELAKYLNRSYWEQRKISESSSMASPSAPSPM-PPTPQP-------------------- 359

Mouse   389 QPITPCSGPFSEQYQNGESEESHEQFLKALQNAVSTFVNRMKSNHMRGRSITNDSAVLSLFQSIN 453
            |.|.|.....:::.|       .::|...::..|..||||||||..|||||:|||:|.:||.::.
  Fly   360 QQIMPLQVKSADEVQ-------IDEFAANMRTQVEIFVNRMKSNSSRGRSISNDSSVQTLFMTLT 417

Mouse   454 TMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQ 518
            ::|.|.|..:.::|::|::||.|||||.||:|:|.||..||:||.|||||.|||.|||||:|:||
  Fly   418 SLHSQQLSYIKEMDDKRMWYEQLQDKLTQIKDSRAALDQLRQEHVEKLRRIAEEQERQRQMQMAQ 482

Mouse   519 KLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPTAG 583
            ||:|||:||||||:.|||||:||:||||:|.|:|.||||....|....|  |.||....|:|..|
  Fly   483 KLDIMRKKKQEYLQYQRQLALQRIQEQEREMQLRQEQQKAQYLMGQSAP--PFPYMPPSAVPQHG 545

Mouse   584 GVLYQPSGPTSFPATFSP-AGSVEGSPMHGVYMSQ-PAPAT---GPYPSMPGTTADPSMVSAYMY 643
            ...:|.:.      .::| |..|.|      |:.| ||||.   |.:.::|....:|::      
  Fly   546 SPSHQLNN------VYNPYAAGVPG------YLPQGPAPAPNGHGQFQAIPPGMYNPAI------ 592

Mouse   644 PTGAPGAQAAPQAQAGPTTSPAYSSYQPTPTPGYQSVASQAPQSLP------------AISQPPQ 696
                       |....|...|.....||.| ||       .||.:|            ||.|.||
  Fly   593 -----------QQPMPPNLQPGGLMQQPAP-PG-------NPQMMPPMPENQFANNPAAILQLPQ 638

Mouse   697 TSNIGYMGSQPMSMGYQPYNMQ-PGGSVCVWSQITQCRAPSYFPQNLMTALPGQD-ASLPAQQP- 758
            ..:|    :||..:.:||...| ||            :.|...|......:|||. ..:|.||| 
  Fly   639 QHSI----AQPPQIPFQPQPQQIPG------------QQPQQIPGQQPQQIPGQQPQQIPGQQPQ 687

Mouse   759 YIPGQQP----------LYQQMAPSTGPPQQQPPV------------AQPAPTQ---GP-PAQGS 797
            .||.|||          |.|..||   |..|.|||            |.|||.|   || |.:..
  Fly   688 QIPVQQPQPQPQMGHVMLQQHQAP---PAAQAPPVTEIANNQVQAVAAAPAPPQNEPGPAPVKAE 749

Mouse   798 E---AQLISFD 805
            |   |:|||||
  Fly   750 EPATAELISFD 760

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HgsXP_006532333.2 VHS_Hrs_Vps27p 4..145 CDD:239626 69/138 (50%)
FYVE_Hrs 159..219 CDD:277260 35/60 (58%)
BASP1 220..397 CDD:283191 65/185 (35%)
Hrs_helical 413..507 CDD:289018 50/94 (53%)
GBP_C <492..566 CDD:303769 50/74 (68%)
DUF1421 525..>769 CDD:284607 86/274 (31%)
coiled coil 537..548 CDD:293879 8/11 (73%)
HrsNP_525099.3 VHS_Hrs_Vps27p 2..143 CDD:239626 69/138 (50%)
FYVE_Hrs 157..217 CDD:277260 35/60 (58%)
Hrs_helical 377..471 CDD:289018 50/94 (53%)
GBP_C <456..520 CDD:303769 47/64 (73%)
coiled coil 501..512 CDD:293879 8/11 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C248379606
eggNOG 1 0.900 E1_KOG1818
Hieranoid 1 1.000
Homologene 1 1.000 H37954
Inparanoid 1 1.050 545 1.000 Inparanoid score I1139
Isobase 1 0.950 0.811278 Normalized mean entropy S3060
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003743
OrthoInspector 1 1.000 T1083552
orthoMCL 1 0.900 OOG5_130171
Panther 1 1.100 LDO PTHR46275
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1647
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.