DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hgs and CG15602

DIOPT Version :8

Sequence 1:XP_006532333.2 Gene:Hgs / 15239 MGIID:104681 Length:805 Species:Mus musculus
Sequence 2:NP_001285298.1 Gene:CG15602 / 32533 FlyBaseID:FBgn0030694 Length:342 Species:Drosophila melanogaster

Alignment Length:346 Identity:71/347 (20%)
Similarity:122/347 (35%) Gaps:112/347 (32%)


Mouse   166 CHRCRVQFGVVTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNK-KAEGKASS 229
            |..|..::|:..:::.|..||..||.||..:...:|:.. .|...||..||::|:| :|...|..
  Fly     3 CFGCGRKYGLFCKEYGCPNCGYSFCSKCLKRPMPVPRHA-GKVHNVCLICY
DKLSKLQASADAEK 66

Mouse   230 TTE---LPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERMRQKTTYTAHPK 291
            ..:   ||...:|                      ::.||                         
  Fly    67 VIDCDALPGILVT----------------------KMNLA------------------------- 84

Mouse   292 AEPTPLASSAPPAGSLY--SSPV---TQCLSPQNSSAPLAED----IDPELARYLNRNYWEKKQE 347
                |.:.|:..|.:|:  |.||   .|.|.|.:||:|.::|    ||..|...|.:...:.|:.
  Fly    85 ----PPSKSSDGADALFNDSLPVEELPQALVPSSSSSPHSKDHKDHIDENLDSELTKRMQDYKRV 145

Mouse   348 EARKSPTPSAPVPLTEPAAQPGEGHTAPNSMAEAPLPETDSQPITPCSGPFSEQYQNGESEESHE 412
            :|......:....||      |..||......:. |..||               |..:.|:..:
  Fly   146 DATDDEIRTRLANLT------GMPHTKSYDKKDL-LLSTD---------------QRNDQEKMRD 188

Mouse   413 ---QFLKALQ----------NAVSTFVNRMKSNHMRGRSITNDSA-VLSLFQSINTMHPQLLELL 463
               ||:...|          :::|....|:::  :|...:.:|:. ..|..:||..         
  Fly   189 LLAQFVDEAQLDQNISRQRDDSISDIERRLRA--LRDTPVDSDACPSRSQMESIAD--------- 242

Mouse   464 NQLDERRLYYEGLQDKLAQIR 484
            |:.|:..|....|:..:|:.|
  Fly   243 NEEDDETLLQNILKKYVAESR 263

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HgsXP_006532333.2 VHS_Hrs_Vps27p 4..145 CDD:239626
FYVE_Hrs 159..219 CDD:277260 16/53 (30%)
BASP1 220..397 CDD:283191 36/190 (19%)
Hrs_helical 413..507 CDD:289018 16/84 (19%)
GBP_C <492..566 CDD:303769
DUF1421 525..>769 CDD:284607
coiled coil 537..548 CDD:293879
CG15602NP_001285298.1 PHD_SF 2..52 CDD:304600 15/50 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1818
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.