DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hcn3 and CG42260

Sequence 1:NP_032253.1 Gene:Hcn3 MGIID:1298211 Length:779 Species:Mus musculus
Sequence 2:NP_001356969.1 Gene:CG42260 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster

Alignment Length:777 Identity:186/778 (24%)
Similarity:312/778 (40%) Gaps:163/778 (21%)


Mouse     7 PAAGAGEAATPARETPPAAPAQARAASGGVPESAPEPKRRQLGTLLQPTVNKFSLRVFGSH---- 67
            |:.|......|.....|..|....|.|||  .|.|                       |||    
  Fly   508 PSQGGPGGPGPPHGGHPHHPHHGGAGSGG--GSGP-----------------------GSHGGQP 547

Mouse    68 ---KAVEIEQERVKSAGA-----WIIHPYSDFRFYWDLIMLLLMVGNLIVLPVGITFFKEENSPP 124
               |......:|:::|.|     ::..|.....:||.:::.:..:.|..|:..... |:|.|...
  Fly   548 HHQKPRRTASQRIRAATAARKLHFVFDPAGRLCYYWSMVVSMAFLYNFWVIIYRFA-FQEINRRT 611

Mouse   125 ---WIVFNVLSDTFFLLDLVLNFRTGIVVEEGAEILLAPRA--IRTRYLR-TWFLVDLISSIPVD 183
               |...:.|||..:|:|::.:|||| .:|:|   :|...|  :||.|:. |.|.:|.:..:|:|
  Fly   612 IAIWFCLDYLSDFLYLIDILFHFRTG-YLEDG---VLQTDALKLRTHYMNSTIFYIDCLCLLPLD 672

Mouse   184 YIFLVVELEPRLDAEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVV 248
            :::|                    .:.|..||...||:::.|...::.:.|.  |..|   ..:.
  Fly   673 FLYL--------------------SIGFNSILRSFRLVKIYRFWAFMDRTER--HTNY---PNLF 712

Mouse   249 RIFNLIGMMLLLCHWDGCLQFLVPMLQDFPSDCWVSMNRMVNHSWGRQYSHALFKAMSHMLCIGY 313
            |...||..:|::.||:|||..::.....|.|..|| .:...:....:||..:.:.....:..|| 
  Fly   713 RSTALIHYLLVIFHWNGCLYHIIHKNNGFGSRNWV-YHDSESADVVKQYLQSYYWCTLALTTIG- 775

Mouse   314 GQQAPVGMPDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPAD 378
            ....|....:....:|.::.|...:|..:||...::.|:.::|:::|.|...|:.||...::|..
  Fly   776 DLPKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAARKEFQAKLDGVKTYMRMRRVPNH 840

Mouse   379 TRQRIHEYYEHRY-QGKMFDEESILGELSEPLREEIINFTCRGLVAHMPLFAHADPSFVTAVLTK 442
            .:.::.:::::.: ..|..|||..:..|.:.|:.||........:..:.:|.:.:..|:..::.:
  Fly   841 LQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDTLKRVEIFQNTEAGFLCELVLR 905

Mouse   443 LRFEVFQPGDLVVREGSVGRKMYFIQHGLLSVLARGARD--TRLTDGSYFGEICLLTRG----RR 501
            ||..:|.|||.:.|:|.||::||.:..|.|.|:|...:.  ..|..|||||||.:|..|    ||
  Fly   906 LRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVADNGKTVMASLKAGSYFGEISILNMGTAGNRR 970

Mouse   502 TASVRADTYCRLYSLSVDHFNAVLEEFPMMRRAFETVAMDRLRRIGKKN-------SILQRKRSE 559
            |||||:..|..|:.||......||:|:|..|...|::|:.||.:..|..       :::...|.:
  Fly   971 TASVRSVGYSDLFVLSKKDMWDVLKEYPAARVRLESIAVKRLEKYKKAPLEKVKYFNVVAMGRCQ 1035

Mouse   560 PSPG--------------------SSGGVMEQHLV---QHDRDMARGVRGLAPGTGARLSGKPVL 601
            .:||                    .:..:|..|..   ||.....:..|..:..|.::..|    
  Fly  1036 STPGLVESCGRTSLEEMWLPPATAGASSLMHHHQALQQQHQASQQQPHRQESTQTSSQTHG---- 1096

Mouse   602 WEPLVHAPLQAAAVTSNVAIALTHQRGPLPLSPDSPATLLARSARRSAGSPASPLVPVRAGPLLA 666
            :.|..:|...|.|..|           |..:||         ||..|...|.|            
  Fly  1097 YSPRSYADRLARATDS-----------PRSVSP---------SAHGSEERPRS------------ 1129

Mouse   667 RGPWASTS----RLPAPPARTLHASLSRTGRSQVSLLGPPPGGGARRLGPRGRPLSASQPSL 724
                .:||    |..:.|:.|.|...|   .||:...|...||.    |....||..|...|
  Fly  1130 ----RTTSHHSIRPQSQPSHTGHICDS---SSQLECYGAGVGGA----GGGTTPLLGSHEVL 1180

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hcn3NP_032253.1 Involved in subunit assembly. {ECO:0000250} 45..90 8/57 (14%)
Ion_trans_N 48..90 CDD:312050 8/54 (15%)
Ion_trans 92..357 CDD:306908 64/271 (24%)
Interaction with KCTD3. {ECO:0000269|PubMed:23382386} 353..779 104/414 (25%)
CAP_ED 427..535 CDD:237999 44/114 (39%)
Atrophin-1 <585..773 CDD:331285 33/145 (23%)
CG42260NP_001356969.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 217 1.000 Inparanoid score I3562
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.