DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hcn2 and CG42260

Sequence 1:NP_032252.1 Gene:Hcn2 MGIID:1298210 Length:863 Species:Mus musculus
Sequence 2:NP_001356969.1 Gene:CG42260 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster

Alignment Length:861 Identity:201/862 (23%)
Similarity:323/862 (37%) Gaps:237/862 (27%)


Mouse    45 TTPSHPESADEP---GPRARLCSRDSACTPGAAKGGANGECGRGEPQCSPEGPARGPKVSFSCRG 106
            |...||.:...|   ||..          ||...||            .|..|..|        |
  Fly   497 TVSHHPHAHGPPSQGGPGG----------PGPPHGG------------HPHHPHHG--------G 531

Mouse   107 AASGPSAAEEAGSEEAGPAGEPRGSQASFLQRQFGALLQPGVNKFSLRMFGSQKAVEREQERVKS 171
            |.||      .||......|:|.                            .||......:|:::
  Fly   532 AGSG------GGSGPGSHGGQPH----------------------------HQKPRRTASQRIRA 562

Mouse   172 AGA-----WIIHPYSDFRFYWDFTMLLFMVGNLIIIPVGITF--FKDETTAPWIVFNVVSDTFFL 229
            |.|     ::..|.....:||...:.:..:.|..:|.....|  ....|.|.|...:.:||..:|
  Fly   563 ATAARKLHFVFDPAGRLCYYWSMVVSMAFLYNFWVIIYRFAFQEINRRTIAIWFCLDYLSDFLYL 627

Mouse   230 MDLVLNFRTGIVIEDNTEIILDPEKIKKKYLR-TWFVVDFVSSIPVDYIFLIVEKGIDSEVYKTA 293
            :|::.:|||| .:||.. :..|..|::..|:. |.|.:|.:..:|:|:::|              
  Fly   628 IDILFHFRTG-YLEDGV-LQTDALKLRTHYMNSTIFYIDCLCLLPLDFLYL-------------- 676

Mouse   294 RALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVMRICNLISMMLLLCHWDGCLQ 358
                .:.|..||...||:::.|...::.:.|.  |..|   ..:.|...||..:|::.||:|||.
  Fly   677 ----SIGFNSILRSFRLVKIYRFWAFMDRTER--HTNY---PNLFRSTALIHYLLVIFHWNGCLY 732

Mouse   359 FLVPMLQDFPSDCWVSINN---------MVNHSWSELYSFALFKAMSHMLCIGYGRQAPESMTDI 414
            .::.....|.|..||..::         :.::.|..|          .:..|| ....|.|..:.
  Fly   733 HIIHKNNGFGSRNWVYHDSESADVVKQYLQSYYWCTL----------ALTTIG-DLPKPRSKGEY 786

Mouse   415 WLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEH 479
            ...:|.::.|...:|..:||...::.|:.::|:::|.|...|:.||...::|...:.|:..::::
  Fly   787 VFVILQLLFGLMLFATVLGHVANIVTSVSAARKEFQAKLDGVKTYMRMRRVPNHLQVKVIKWFDY 851

Mouse   480 RY-QGKMFDEDSILGELNGPLREEI-VNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGD 542
            .: ..|..||:..:..|...|:.|| :|.:...| ..:.:|.|.:..|:..::.:|:..:|.|||
  Fly   852 LWLTQKCSDEERAVSCLPDKLKAEIAINVHLDTL-KRVEIFQNTEAGFLCELVLRLRPVLFSPGD 915

Mouse   543 YIIREGTIGKKMYFIQHGVVSVLTKGNKEM--KLSDGSYFGEICLLTRG----RRTASVRADTYC 601
            ||.|:|.:||:||.:..|.:.|:....|.:  .|..|||||||.:|..|    |||||||:..|.
  Fly   916 YICRKGEVGKEMYIVNRGRLQVVADNGKTVMASLKAGSYFGEISILNMGTAGNRRTASVRSVGYS 980

Mouse   602 RLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLHKVQHDLSSGVFNNQENAIIQE 666
            .|:.||..:..:||:|||..|...|::|:.||::..|..   |.||::      ||         
  Fly   981 DLFVLSKKDMWDVLKEYPAARVRLESIAVKRLEKYKKAP---LEKVKY------FN--------- 1027

Mouse   667 IVKYDREMVQQAELGQRVGLFPPPPPPQVTSAIATLQQAVAMSFCPQVARPLVGPLALGSPRLVR 731
                                                  .|||..|.            .:|.||.
  Fly  1028 --------------------------------------VVAMGRCQ------------STPGLVE 1042

Mouse   732 RAPPGP-----LPPAASPGPP-----AASPPAAPSSPRAPRTSPYGVPGSPATRVGPALPARRLS 786
            ......     ||||.:....     .|......:|.:.|.........|......|...|.||:
  Fly  1043 SCGRTSLEEMWLPPATAGASSLMHHHQALQQQHQASQQQPHRQESTQTSSQTHGYSPRSYADRLA 1107

Mouse   787 RASRPLSASQPSLPHGVPAPSPAASARPASSST------PRLGPAPTARTAAPSPDRRDSASP-- 843
            ||:....:..|| .||       :..||.|.:|      |:..|:.|....       ||:|.  
  Fly  1108 RATDSPRSVSPS-AHG-------SEERPRSRTTSHHSIRPQSQPSHTGHIC-------DSSSQLE 1157

Mouse   844 -------GAASGLDPL 852
                   ||..|..||
  Fly  1158 CYGAGVGGAGGGTTPL 1173

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hcn2NP_032252.1 Involved in subunit assembly 131..182 6/56 (11%)
Ion_trans_N 140..182 CDD:285597 6/47 (13%)
Ion_trans 202..447 CDD:278921 59/257 (23%)
Crp 511..>646 CDD:223736 53/141 (38%)
CAP_ED 517..625 CDD:237999 46/114 (40%)
CG42260NP_001356969.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 217 1.000 Inparanoid score I3562
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.