DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CTSV and CG11459

Sequence 1:NP_001188504.1 Gene:CTSV HGNCID:2538 Length:334 Species:Homo sapiens
Sequence 2:NP_001287191.1 Gene:CG11459 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster

Alignment Length:325 Identity:116/326 (36%)
Similarity:182/326 (56%) Gaps:35/326 (11%)


Human    26 DTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIELHNGEYSQGKHGFTMAMNAFGDMTNEEFRQ 90
            ||:|.|:||.:.:.| .|.:.:.||::|:.:..:|.||..|.|||..|.|.:|.|.| |::..  
  Fly    27 DTEWDQYKAKYNKQY-RNRDKYHRALYEQRVLAVESHNQLYLQGKVAFKMGLNKFSD-TDQRI-- 87

Human    91 MMGCFRNQKFRKGKVFREPL---------------FLDLPKSVDWRKKGYVTPVKNQ-KQCGSCW 139
                    .|........||               :..:.:.:|||:.||::||.:| .:|.|||
  Fly    88 --------LFNYRSSIPAPLETSTNALTETVNYKRYDQITEGIDWRQYGYISPVGDQGTECLSCW 144

Human   140 AFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPY 204
            |||.:|.||..|.:|.|.||.||.::||||. |..|.||:||:::.||.|.::: |:.::|||||
  Fly   145 AFSTSGVLEAHMAKKYGNLVPLSPKHLVDCV-PYPNNGCSGGWVSVAFNYTRDH-GIATKESYPY 207

Human   205 VAVDEICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPD 269
            ..|...|.::.:.|....:|:..:....|:.|.:.|..:||::|::|..|..|..|..|:...|.
  Fly   208 EPVSGECLWKSDRSAGTLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLHEEFDQYSGGVLSIPA 272

Human   270 CSSK--NLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYP 332
            |.||  :|.|.||:||:   |.:.....||::|||:|.:||.:||:|:|::.||.||:|:...||
  Fly   273 CRSKRQDLTHSVLLVGF---GTHRKWGDYWIIKNSYGTDWGESGYLKLARNANNMCGVASLPQYP 334

Human   333  332
              Fly   335  334

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CTSVNP_001188504.1 Inhibitor_I29 29..87 CDD:214853 22/58 (38%)
Peptidase_C1 114..332 CDD:306594 88/221 (40%)
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 22/57 (39%)
Peptidase_C1A 120..334 CDD:239068 88/219 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87870907
eggNOG 1 0.900 E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12411
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.