DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CTSV and CtsF

DIOPT Version :9

Sequence 1:NP_001324.2 Gene:CTSV / 1515 HGNCID:2538 Length:334 Species:Homo sapiens
Sequence 2:NP_730901.1 Gene:CtsF / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster


Alignment Length:320 Identity:125/320 - (39%)
Similarity:181/320 - (56%) Gaps:19/320 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    20 KFDQNLDTKWYQWKATH-RRLYGANEEGWRRAVWEKNMKMI-ELHNGEYSQGKHGFTMAMNAFGD 82
            :||: :|..:|:::... ||.....|...|..::.:|:|.| ||:..|....|:|.|    .|.|
  Fly   300 RFDK-VDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNANEMGSAKYGIT----EFAD 359

Human    83 MTNEEFRQMMGCFRNQ--KFRKGKVFREPLFL-DLPKSVDWRKKGYVTPVKNQKQCGSCWAFSAT 144
            ||:.|:::..|.::..  |...|.....|.:. :|||..|||:|..||.||||..||||||||.|
  Fly   360 MTSSEYKERTGLWQRDEAKATGGSAAVVPAYHGELPKEFDWRQKDAVTQVKNQGSCGSCWAFSVT 424

Human   145 GALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDE 209
            |.:||....|||:|...|||.|:||...  :..||||.|..|::.:|:.|||:.|..|||.|...
  Fly   425 GNIEGLYAVKTGELKEFSEQELLDCDTT--DSACNGGLMDNAYKAIKDIGGLEYEAEYPYKAKKN 487

Human   210 ICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIY--FEPDCSS 272
            .|.:....|.....||..:..|.|.|:.:.:...||||:.::|  ::.|||:.|:.  ::..||.
  Fly   488 QCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINA--NAMQFYRGGVSHPWKALCSK 550

Human   273 KNLDHGVLVVGYGF-EGANSNNS-KYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAAS 330
            |||||||||||||. :..|.:.: .||:|||||||.||..||.::.:. :|.||::..|:
  Fly   551 KNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRG-DNTCGVSEMAT 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CTSVNP_001324.2 Inhibitor_I29 29..87 CDD:214853 18/59 (31%)
Peptidase_C1 114..332 CDD:425470 99/221 (45%)
CtsFNP_730901.1 Inhibitor_I29 308..365 CDD:462410 18/60 (30%)
Peptidase_C1A 395..611 CDD:239068 98/220 (45%)


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - -
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.