DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CTSV and 26-29-p

Sequence 1:NP_001188504.1 Gene:CTSV HGNCID:2538 Length:334 Species:Homo sapiens
Sequence 2:NP_620470.1 Gene:26-29-p FlyBaseID:FBgn0250848 Length:549 Species:Drosophila melanogaster

Alignment Length:318 Identity:125/319 (39%)
Similarity:176/319 (55%) Gaps:17/319 (5%)


Human    22 DQNLDTKWYQWKATHRRLYGAN-EEGWRRAVWEKNMKMIELHNGEYSQGKHGFTMAMNAFGDMTN 85
            |:::|..::.:|..|...|.:: |...|:.::.:|::.|...|    :.|..:|:|:|...|.|.
  Fly   238 DEHVDKAFHHFKRKHGVAYHSDTEHEHRKNIFRQNLRYIHSKN----RAKLTYTLAVNHLADKTE 298

Human    86 EEFRQMMGCFRNQKFRKGKVF--REPLFLD-LPKSVDWRKKGYVTPVKNQKQCGSCWAFSATGAL 147
            ||.:...|...:..:..||.|  ..|.:.| :|...|||..|.|||||:|..|||||:|...|.|
  Fly   299 EELKARRGYKSSGIYNTGKPFPYDVPKYKDEIPDQYDWRLYGAVTPVKDQSVCGSCWSFGTIGHL 363

Human   148 EGQMFRKT-GKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESY-PYVAVDEI 210
            ||..|.|. |.||.||:|.|:|||...||.||:||...|.:|::.::||:.:||.| ||:..|..
  Fly   364 EGAFFLKNGGNLVRLSQQALIDCSWAYGNNGCDGGEDFRVYQWMLQSGGVPTEEEYGPYLGQDGY 428

Human   211 CKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSS--K 273
            |.......||...||..|......|...|:...||:|||:||...:|.||..|:|:||.|.:  .
  Fly   429 CHVNNVTLVAPIKGFVNVTSNDPNAFKLALLKHGPLSVAIDASPKTFSFYSHGVYYEPTCKNDVD 493

Human   274 NLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASY 331
            .|||.||.||||    :.|...||||||||...||::||:.::..||| ||:.|..:|
  Fly   494 GLDHAVLAVGYG----SINGEDYWLVKNSWSTYWGNDGYILMSAKKNN-CGVMTMPTY 546

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CTSVNP_001188504.1 Inhibitor_I29 29..87 CDD:214853 15/59 (25%)
Peptidase_C1 114..332 CDD:306594 101/223 (45%)
26-29-pNP_620470.1 Inhibitor_I29 245..300 CDD:214853 15/59 (25%)
Peptidase_C1A 331..547 CDD:239068 101/222 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87410481
eggNOG 1 0.900 E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.