DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CTSV and CG4847

Sequence 1:NP_001188504.1 Gene:CTSV HGNCID:2538 Length:334 Species:Homo sapiens
Sequence 2:NP_725686.1 Gene:CG4847 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster

Alignment Length:332 Identity:129/333 (39%)
Similarity:179/333 (54%) Gaps:18/333 (5%)


Human    14 IASAVPKFD--QNLDTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIELHNGEYSQGKHGFTMA 76
            ||.||||..  .|:.........:.:....|.:.......:.....::|..|..::||.|.|..|
  Fly    96 IAKAVPKVPLLSNVQDFGDFLSQSGKTYLSAADRALHEGAFASTKNLVEAGNAAFAQGVHTFKQA 160

Human    77 MNAFGDMTNEEF-RQMMGCFRNQKFRKG-----KVFREPLFLDLPKSVDWRKKGYVTPVKNQKQC 135
            :|||.|:|:.|| .|:.|..|:.:.:..     |:...|. ..:|.:.|||:.|.|||||.|..|
  Fly   161 VNAFADLTHSEFLSQLTGLKRSPEAKARAAASLKLVNLPA-KPIPDAFDWREHGGVTPVKFQGTC 224

Human   136 GSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQ--GNQGCNGGFMARAFQYVKE-NGGLD 197
            ||||||:.|||:||..|||||.|.:|||||||||...:  |..||:|||...||.::.| ..|:.
  Fly   225 GSCWAFATTGAIEGHTFRKTGSLPNLSEQNLVDCGPVEDFGLNGCDGGFQEAAFCFIDEVQKGVS 289

Human   198 SEESYPYVAVDEICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKS 262
            .|.:|||:.....|||....|.|...||..:.|..|:.|.|.|||:||::.::: |..:.:.|..
  Fly   290 QEGAYPYIDNKGTCKYDGSKSGATLQGFAAIPPKDEEQLKKVVATLGPVACSVN-GLETLKNYAG 353

Human   263 GIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIAT 327
            |||.:.:|:....:|.:||||||.|    ....||:|||||...||..||.::.:.| |:|.||.
  Fly   354 GIYNDDECNKGEPNHSILVVGYGSE----KGQDYWIVKNSWDDTWGEKGYFRLPRGK-NYCFIAE 413

Human   328 AASYPNV 334
            ..|||.|
  Fly   414 ECSYPVV 420

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CTSVNP_001188504.1 Inhibitor_I29 29..87 CDD:214853 13/58 (22%)
Peptidase_C1 114..332 CDD:306594 100/221 (45%)
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458 14/60 (23%)
Peptidase_C1A 204..418 CDD:239068 100/220 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12411
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.