DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CTSV and Cp1

Sequence 1:NP_001188504.1 Gene:CTSV HGNCID:2538 Length:334 Species:Homo sapiens
Sequence 2:NP_523735.2 Gene:Cp1 FlyBaseID:FBgn0013770 Length:371 Species:Drosophila melanogaster

Alignment Length:334 Identity:171/335 (51%)
Similarity:224/335 (67%) Gaps:16/335 (5%)


Human    12 LGIASAVPKFDQNLDTKWYQWKATHRRLY-GANEEGWRRAVWEKNMKMIELHNGEYSQGKHGFTM 75
            |.:|.||...|..:: :|:.:|..||:.| ...||.:|..::.:|...|..||..:::||..|.:
  Fly    43 LAVAQAVSFADVVME-EWHTFKLEHRKNYQDETEERFRLKIFNENKHKIAKHNQRFAEGKVSFKL 106

Human    76 AMNAFGDMTNEEFRQMMGCFR----------NQKFRKGKVFREPLFLDLPKSVDWRKKGYVTPVK 130
            |:|.:.|:.:.||||:|..|.          ::.| ||..|..|..:.||||||||.||.||.||
  Fly   107 AVNKYADLLHHEFRQLMNGFNYTLHKQLRAADESF-KGVTFISPAHVTLPKSVDWRTKGAVTAVK 170

Human   131 NQKQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGG 195
            :|..||||||||:|||||||.|||:|.|||||||||||||...||.|||||.|..||:|:|:|||
  Fly   171 DQGHCGSCWAFSSTGALEGQHFRKSGVLVSLSEQNLVDCSTKYGNNGCNGGLMDNAFRYIKDNGG 235

Human   196 LDSEESYPYVAVDEICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFY 260
            :|:|:||||.|:|:.|.:......|.|.|||.:..|.||.:.:|||||||:|||:||.|.|||||
  Fly   236 IDTEKSYPYEAIDDSCHFNKGTVGATDRGFTDIPQGDEKKMAEAVATVGPVSVAIDASHESFQFY 300

Human   261 KSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGI 325
            ..|:|.||.|.::||||||||||:   |.:.:...|||||||||..||..|::|:.::|.|.|||
  Fly   301 SEGVYNEPQCDAQNLDHGVLVVGF---GTDESGEDYWLVKNSWGTTWGDKGFIKMLRNKENQCGI 362

Human   326 ATAASYPNV 334
            |:|:|||.|
  Fly   363 ASASSYPLV 371

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CTSVNP_001188504.1 Inhibitor_I29 29..87 CDD:214853 18/59 (31%)
Peptidase_C1 114..332 CDD:306594 135/218 (62%)
Cp1NP_523735.2 Inhibitor_I29 59..118 CDD:214853 18/59 (31%)
Peptidase_C1 154..370 CDD:278538 136/219 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4870
Hieranoid 1 1.000
Homologene 1 1.000 H76699
Inparanoid 1 1.050 360 1.000 Inparanoid score I2178
Isobase 1 0.950 0 Normalized mean entropy S2922
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000400
OrthoInspector 1 1.000 T609457
orthoMCL 1 0.900 OOG5_126607
Panther 1 1.100 LDO PTHR12411
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3411
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.930

Return to query results.
Submit another query.