DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CTSV and CG6357

Sequence 1:NP_001188504.1 Gene:CTSV HGNCID:2538 Length:334 Species:Homo sapiens
Sequence 2:NP_610907.1 Gene:CG6357 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster

Alignment Length:74 Identity:20/75 (27%)
Similarity:34/75 (45%) Gaps:10/75 (13%)


Human    16 SAVPKFDQNLDTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIELHNGEYSQGKHGFTMAMNAF 80
            :|..||..:...|:...|.|.:          ||.::..|.|.|:.||.::..|...|...:|.:
  Fly   345 AAWKKFLIDFGAKYQDEKETEK----------RRTIFCDNWKAIQEHNEQFELGVESFKKGINQW 399

Human    81 GDMTNEEFR 89
            .|:|.||::
  Fly   400 SDLTVEEWK 408

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CTSVNP_001188504.1 Inhibitor_I29 29..87 CDD:214853 15/58 (26%)
Peptidase_C1 114..332 CDD:306594
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:285458
Inhibitor_I29 162..221 CDD:214853
Inhibitor_I29 252..311 CDD:214853
Inhibitor_I29 347..406 CDD:214853 18/69 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.