DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CTSV and CG6347

DIOPT Version :9

Sequence 1:NP_001188504.1 Gene:CTSV / 1515 HGNCID:2538 Length:334 Species:Homo sapiens
Sequence 2:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster


Alignment Length:350 Identity:125/350 - (35%)
Similarity:189/350 - (54%) Gaps:28/350 - (8%)


- Green bases have known domain annotations that are detailed below.


Human     1 MNLSL-VLAAFCLGIASAVPKF--DQNLDTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIELH 62
            |.|.| :|.|..|....:.||.  .||.|    .:.....::|...|..:|.:::...|.:|.|.
  Fly    11 MTLGLALLGAVSLQQLQSFPKLCDVQNFD----DFLRQTGKVYSDEERVYRESIFAAKMSLITLS 71

Human    63 NGEYSQGKHGFTMAMNAFGDMTNEEFRQMMGC----FRNQKFRKGKV----FREPLFLDLPKSVD 119
            |.....|..||.:.:|...|||.:|...::|.    | .:::..|.:    .|.|...:||:..|
  Fly    72 NKNADNGVSGFRLGVNTLADMTRKEIATLLGSKISEF-GERYTNGHINFVTARNPASANLPEMFD 135

Human   120 WRKKGYVTPVKNQ-KQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFM 183
            ||:||.|||...| ..||:||:|:.||||||.:||:||.|.|||:||||||:...||.||:|||.
  Fly   136 WREKGGVTPPGFQGVGCGACWSFATTGALEGHLFRRTGVLASLSQQNLVDCADDYGNMGCDGGFQ 200

Human   184 ARAFQYVKENGGLDSEESYPYVAVDEICKYR------PENSVANDTGFTVVAPGKEKALMKAVAT 242
            ...|:|:::: |:.....|||...:..|:..      |..|:.....:..:.||.|:.:.:.:||
  Fly   201 EYGFEYIRDH-GVTLANKYPYTQTEMQCRQNETAGRPPRESLVKIRDYATITPGDEEKMKEVIAT 264

Human   243 VGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEW 307
            :||::.:|:|...||:.|..|||.:.:|:...|:|.|.|||||.|    |...||::|||:...|
  Fly   265 LGPLACSMNADTISFEQYSGGIYEDEECNQGELNHSVTVVGYGTE----NGRDYWIIKNSYSQNW 325

Human   308 GSNGYVKIAKDKNNHCGIATAASYP 332
            |..|:::|.::....||||:..|||
  Fly   326 GEGGFMRILRNAGGFCGIASECSYP 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CTSVNP_001188504.1 Inhibitor_I29 29..87 CDD:214853 14/57 (25%)
Peptidase_C1 114..332 CDD:306594 92/224 (41%)
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 15/62 (24%)
Peptidase_C1A 131..350 CDD:239068 91/223 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149670
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.