DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CTSV and CG6337

Sequence 1:NP_001188504.1 Gene:CTSV HGNCID:2538 Length:334 Species:Homo sapiens
Sequence 2:NP_001286395.1 Gene:CG6337 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster

Alignment Length:316 Identity:72/317 (23%)
Similarity:121/317 (38%) Gaps:70/317 (22%)


Human    55 NMKMIELHNGEYSQGKHGFTMAMNAFGDMTNEEFRQMMGCFRNQKFRKGKVFREPLFLDLPKSVD 119
            |...:..||.:..:.:..:..|:|.|.|:...:|..:                      |||:|:
  Fly    55 NRNQVAQHNAQADRNRTTYREAVNQFSDIRLIQF
AAL----------------------LPKAVN 97

Human   120 WRKKGYVTPVKNQK----------------------QCGSCWAFSATGALEGQMFRKTGKLV--S 160
            ........|..:|.                      .|.|.||::...|:|.....:|...:  |
  Fly    98 TVTSAASDPPASQAASASFDIITDFGLTVAVEDQGVNCSSSWAYATAKAVEIMNAVQTANPLPSS 162

Human   161 LSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVD----------EICKYRP 215
            ||.|.|:||:..  ..||:......|..|:.:     ..::|.|..||          .:|  :|
  Fly   163 LSAQQLLDCAGM--GTGCSTQTPLAALNYLTQ-----LTDAYLYPEVDYPNNNSLKTPGMC--QP 218

Human   216 ENSVA---NDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDH 277
            .:||:   ...|::.||...:.|:|:.|:...|:.|..:.....|..|.||:|.:...:..|...
  Fly   219 PSSVSVGVKLAGYSTVADNDDAAVMRYVSNGFPVIVEYNPATFGFMQYSSGVYVQETRALTNPKS 283

Human   278 GVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYPN 333
            ...:|..|::....:|..||...||:|..||..||::|.:..|.  .||..|.:|:
  Fly   284 SQFLVVVGYDHDVDSNLDYWRCLNSFGDTWGEEGYIRIVRRSNQ--PIAKNAVFPS 337

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CTSVNP_001188504.1 Inhibitor_I29 29..87 CDD:214853 7/32 (22%)
Peptidase_C1 114..332 CDD:306594 63/255 (25%)
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458 7/33 (21%)
Peptidase_C1A 114..336 CDD:239068 57/233 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.