DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CTSV and CG5367

DIOPT Version :9

Sequence 1:NP_001188504.1 Gene:CTSV / 1515 HGNCID:2538 Length:334 Species:Homo sapiens
Sequence 2:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster


Alignment Length:337 Identity:120/337 - (35%)
Similarity:196/337 - (58%) Gaps:20/337 - (5%)


- Green bases have known domain annotations that are detailed below.


Human     1 MNLSLVLAAFCLGIASAVPKFDQNLDTKWYQWKATHRRLYGANEEGWRR-AVWEKNMKMIELHNG 64
            :|..:|.:....|.:|:.     |..:::.::|..:.|.|....:..|. ..:|:|.|:||.||.
  Fly    13 LNCQIVTSNLSEGNSSSA-----NCKSEFEKFKNNNNRKYLRTYDEMRSYKAFEENFKVIEEHNQ 72

Human    65 EYSQGKHGFTMAMNAFGDMTNEEF-----RQMMGCFRNQKFRKGKVFREPLFLDLPKSVDWRKKG 124
            .|.:|:..|.:..|.|.||:.:.:     |.:.....:......::...||..::|:|:|||.||
  Fly    73 NYKEGQTSFRLKPNIFADMSTDGYLKGFLRLLKSNIEDSADNMAEIVGSPLMANVPESLDWRSKG 137

Human   125 YVTPVKNQKQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQY 189
            ::||..||..||||:|||...::.||:|::|||::|||:|.:||||...|||||.||.:.....|
  Fly   138 FITPPYNQLSCGSCYAFSIAESIMGQVFKRTGKILSLSKQQIVDCSVSHGNQGCVGGSLRNTLSY 202

Human   190 VKENGGLDSEESYPYVAVDEICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGH 254
            ::..||:..::.|||||....|::.|:.||.|.|.:.::....|:|:..||..:||::::::|..
  Fly   203 LQSTGGIMRDQDYPYVARKGKCQFVPDLSVVNVTSWAILPVRDEQAIQAAVTHIGPVAISINASP 267

Human   255 SSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDK 319
            .:||.|..|||.:|.|||.:::|.::|:|:|        ..||::||.||..||.|||::|.|..
  Fly   268 KTFQLYSDGIYDDPLCSSASVNHAMVVIGFG--------KDYWILKNWWGQNWGENGYIRIRKGV 324

Human   320 NNHCGIATAASY 331
             |.||||..|:|
  Fly   325 -NMCGIANYAAY 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CTSVNP_001188504.1 Inhibitor_I29 29..87 CDD:214853 18/58 (31%)
Peptidase_C1 114..332 CDD:306594 94/218 (43%)
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 18/59 (31%)
Peptidase_C1A 128..336 CDD:239068 94/217 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149668
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2922
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.