DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CTNNA2 and alpha-Cat

Sequence 1:NP_001269526.1 Gene:CTNNA2 HGNCID:2510 Length:953 Species:Homo sapiens
Sequence 2:NP_524219.1 Gene:alpha-Cat FlyBaseID:FBgn0010215 Length:917 Species:Drosophila melanogaster

Alignment Length:953 Identity:582/954 (61%)
Similarity:732/954 (77%) Gaps:67/954 (7%)


Human     8 IILKWDPKSLEIRTLTVERLLEPLVTQVTTLVNTSNKGPSGKKKGRSKKAHVLAASVEQATQNFL 72
            |.||||||:|||||::||:.|||||.||||||||  ||||.||||:||:|..|.|:||:||:||:
  Fly    16 IALKWDPKNLEIRTMSVEKTLEPLVLQVTTLVNT--KGPSKKKKGKSKRASALVAAVEKATENFI 78

Human    73 EKGEQIAKESQDLKEELVAAVEDVRKQGETMRIASSEFADDPCSSVKRGTMVRAARALLSAVTRL 137
            :||||||.|:.|:.:|::.||::|:|.|:.|.||:.||::|||||:|||.||||||.||||||||
  Fly    79 QKGEQIAYENPDITQEMLTAVDEVKKTGDAMSIAAREFSEDPCSSLKRGNMVRAARNLLSAVTRL 143

Human   138 LILADMADVMRLLSHLKIVEEALEAVKNATNEQDLANRFKEFGKEMVKLNYVAARRQQELKDPHC 202
            ||||||.||..||..|.|||:.|..:|||:::.:|.:..::||:...:|...||:||||||||..
  Fly   144 LILADMVDVHLLLKSLHIVEDDLNKLKNASSQDELMDNMRQFGRNAGELIKQAAKRQQELKDPQL 208

Human   203 RDEMAAARGALKKNATMLYTASQAFLRHPDVAATRANRDYVFKQVQEAIAGISNAAQATS--PTD 265
            ||::||||..|||::|||.|||:.::|||::...:.|||::.|||.:|:..||:.||..|  |||
  Fly   209 RDDLAAARAMLKKHSTMLLTASKVYVRHPELDLAKVNRDFILKQVCDAVNTISDVAQGKSSQPTD 273

Human   266 EAKGHTGIGELAAALNEFDNKIILDPMTFSEARFRPSLEERLESIISGAALMADSSCTRDDRRER 330
            .   ::|.|||||||::||..|::||||:||.|.|..||||||||||.||||||:.||||:||||
  Fly   274 I---YSGAGELAAALDDFDEGIVMDPMTYSEKRSRQLLEERLESIISAAALMADADCTRDERRER 335

Human   331 IVAECNAVRQALQDLLSEYMNNTGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLET 395
            ||||||||||||||||||||:|..:|:....|:.|||:|.:|||||||||||||:||:|||||||
  Fly   336 IVAECNAVRQALQDLLSEYMSNMSQKDNSPGLSRAIDQMCRKTRDLRRQLRKAVVDHVSDSFLET 400

Human   396 NVPLLVLIEAAKSGNEKEVKEYAQVFREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCP 460
            ..|||.|||||||||||:|:|.:::|.:||.||||||||.||:||||:|||:||.||.||:||||
  Fly   401 TTPLLDLIEAAKSGNEKKVREKSEIFTKHAEKLVEVANLVCSMSNNEDGVKMVRYAAAQIESLCP 465

Human   461 QVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCV 525
            ||||||..|..||.|||||:||..::..||.|||:|||||||||::||||:||||||||||||||
  Fly   466 QVINAASILTVRPNSKVAQENMTTYRQAWEVQVRILTEAVDDITTIDDFLAVSENHILEDVNKCV 530

Human   526 IALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENYEAGVYTEKVLEATKLLSETVMPRFAEQVE 590
            :|||.||...|..|||||:||::||.:::.|||:|||..:||::||||.|:|.:.||.:|.::|.
  Fly   531 MALQVGDARDLRATAGAIQGRSSRVCNVVEAEMDNYEPCIYTKRVLEAVKVLRDQVMMKFDQRVG 595

Human   591 VAIEALSANVPQPFEENEFIDASRLVYDGVRDIRKAVLMIRTPEELEDDSDFEQ-ED--YDVRSR 652
            .|:.|||.|..:..:||:|||||||||||||:||:||||.|:.|:|:.|::||. ||  .:.|||
  Fly   596 AAVGALSNNSNKDVDENDFIDASRLVYDGVREIRRAVLMNRSSEDLDTDTEFEPVEDLTLETRSR 660

Human   653 TSVQTEDDQL-----IAG-QSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDI 711
            :|..|.|..:     |:| .:||..|.::.:|:|.|||:|||:|.:||...|:|||||||:||||
  Fly   661 SSAHTGDQTVDEYPDISGICTAREAMRKMTEEDKQKIAQQVELFRREKLTFDSEVAKWDDTGNDI 725

Human   712 IVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLL 776
            |.|||.||||||||||||||:||||.|.|||||||||:|||:::|||.|.:|:|||:|:.|:|||
  Fly   726 IFLAKHMCMIMMEMTDFTRGRGPLKTTMDVINAAKKISEAGTKLDKLTREIAEQCPESSTKKDLL 790

Human   777 AYLQRIALYCHQLNICSKVKAEVQNLGGELIVSGTGVQSTFTTFYEVDCDVIDGGRASQLSTHLP 841
            ||||||||||||:.|.|||||:|||:.|||||||                               
  Fly   791 AYLQRIALYCHQIQITSKVKADVQNISGELIVSG------------------------------- 824

Human   842 TCAEGAPIGSGSSDSSMLDSATSLIQAAKNLMNAVVLTVKASYVASTKYQKVYGTAAVNSPVVSW 906
                             |||||||||||||||||||||||.||||||||.: .||  |:||:|.|
  Fly   825 -----------------LDSATSLIQAAKNLMNAVVLTVKYSYVASTKYTR-QGT--VSSPIVVW 869

Human   907 KMKAPEKKPLVKREKPEEFQTRVRRGSQKKHISPVQALSEFKA 949
            |||||||||||:.|||||.:.:||:|||||..:|:.|||||::
  Fly   870 KMKAPEKKPLVRPEKPEEVRAKVRKGSQKKVQNPIHALSEFQS 912

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CTNNA2NP_001269526.1 Vinculin 81..914 CDD:279395 508/844 (60%)
alpha-CatNP_524219.1 Vinculin 87..877 CDD:279395 508/844 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3681
Hieranoid 1 1.000
Homologene 1 1.000 H68394
Inparanoid 1 1.050 1087 1.000 Inparanoid score I238
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D405587at33208
OrthoFinder 1 1.000 FOG0001371
OrthoInspector 1 1.000 T608893
orthoMCL 1 0.900 OOG5_130411
Panther 1 1.100 LDO PTHR18914
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2575
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.