DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gstt1 and GstD9

Sequence 1:NP_032211.3 Gene:Gstt1 MGIID:107379 Length:240 Species:Mus musculus
Sequence 2:NP_001287303.1 Gene:GstD9 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster

Alignment Length:214 Identity:59/215 (27%)
Similarity:95/215 (44%) Gaps:34/215 (16%)


Mouse     2 VLELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKRVPAMMDGGFTLCE 66
            :|:.|..|.|.|||:|.:.|:...:......|:|..||||...|.::||...:|.::|.||.:.|
  Fly     1 MLDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWE 65

Mouse    67 SVAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTGLRRSCLRALWHKVMFPVFLGEQIPPE 131
            |.|||:|||.||......||:|.|.||.:::.|.:..:.|.:|     :....:|....:...| 
  Fly    66 SRAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQS-----YVYYYYPQLFEDVKKP- 124

Mouse   132 TLAATLAELDVNLQVLEDKFLQDKDFLVGPH------ISLADLVAITELMHPVGGGCPVFE---- 186
                  |:.| ||:.::|.|......|.|..      ::|||...:..:        ..||    
  Fly   125 ------ADPD-NLKKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATV--------STFEISEY 174

Mouse   187 ---GHPRLAAWYQRVEAAV 202
               .:|.:..||...:..:
  Fly   175 DFGKYPEVVRWYDNAKKVI 193

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gstt1NP_032211.3 GstA 3..212 CDD:223698 59/214 (28%)
GST_N_Theta 3..78 CDD:239348 31/75 (41%)
Glutathione binding. {ECO:0000250} 53..54 0/1 (0%)
Glutathione binding. {ECO:0000250} 66..67 1/1 (100%)
GST_C_Theta 91..217 CDD:198292 23/126 (18%)
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 30/73 (41%)
GstA 4..187 CDD:223698 58/204 (28%)
GST_C_Delta_Epsilon 89..207 CDD:198287 24/127 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C95017645
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.