DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and Ir75b

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_001137966.2 Gene:Ir75b FlyBaseID:FBgn0261402 Length:605 Species:Drosophila melanogaster

Alignment Length:446 Identity:97/447 (22%)
Similarity:173/447 (39%) Gaps:121/447 (27%)


Mouse   445 EIAKHVGYSYRLEIVSDGK--YGARDP------------------DTKAWNGMVGELVYGRADVA 489
            ||...:...||:::.:..:  |.||.|                  |..|..||:|:|:..:||:|
  Fly   208 EIFDFMNSKYRIQLDTYARLGYQARQPLRDMLDCKFKYIFRDRWSDGNATGGMIGDLILDKADLA 272

Mouse   490 VAPLTITLVREEVIDFSKPFMSLGI---SIMIKKPQKSKPGVFS--FLDPLAYEIWM-------- 541
            :||...:..|..   |.:|.....:   ..|.:.|:....|:.:  ||.|.:..:|:        
  Fly   273 IAPFIYSFDRAL---FLQPITKFSVFREICMFRNPRSVSAGLSATEFLQPFSGGVWLTFALLLLL 334

Mouse   542 --CIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCD 604
              |:::       |.|::.|..  :|..                  .:..|...|.||...||..
  Fly   335 AGCLLW-------VTFILERRK--QWKP------------------SLLTSCLLSFGAGCIQGAW 372

Mouse   605 ISPRSLSGRIVGGVWWFFTLIIIS-----SYTANLAAFLTVERMVSPIESAEDLAKQ-------- 656
            ::|||:.||:.     ||.|::.|     .||:.:.:.|..:.:.|.|.:.:.||..        
  Fly   373 LTPRSMGGRMA-----FFALMVTSYLMYNYYTSIVVSKLLGQPIKSNIRTLQQLADSNLDVGIEP 432

Mouse   657 ---TEIAYGTLEAGSTKEFFRRSKIAVF---EKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYA 715
               |.|...|.|....::.:|:..:...   :|:|.            .||.|::.||..:| :.
  Fly   433 TVYTRIYVETSEEPDVRDLYRKKVLGSKRSPDKIWI------------PTEAGVLSVRDQEG-FV 484

Mouse   716 YLL-ESTMNEYIEQ----RKPCDTMKVGGNLDSKGYGIATPKGSALRGP----VNLAVLKLSEQG 771
            |:. .:|..|::.:    .:.|:..::.....|..:.:.     |.|.|    :.|:.|::.|.|
  Fly   485 YITGVATGYEFVRKHFLAHQICELNEIPLRDASHTHTVL-----AKRSPYAELIKLSELRMLETG 544

Mouse   772 VLDKLKSKWWYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIE 827
            |..|.:..|...|..|     ...:.|.|:.|...|.:|.||:|.:.|.|.:..:|
  Fly   545 VHFKHERSWMETKLHC-----YQHNHTVAVGLEYAAPLFIILLGAIILCMGILGLE 595

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385
ANF_receptor 37..372 CDD:279440
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 85/405 (21%)
Glutamate binding. {ECO:0000250} 492..494 1/2 (50%)
Lig_chan 538..817 CDD:278489 66/317 (21%)
Glutamate binding. {ECO:0000250} 668..669 0/1 (0%)
PDZ-binding 904..907
Ir75bNP_001137966.2 Periplasmic_Binding_Protein_Type_2 253..553 CDD:304360 75/353 (21%)
Lig_chan 343..585 CDD:278489 63/290 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111036285
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.