DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and Ir7e

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_001138176.1 Gene:Ir7e FlyBaseID:FBgn0259189 Length:608 Species:Drosophila melanogaster

Alignment Length:858 Identity:125/859 (15%)
Similarity:242/859 (28%) Gaps:391/859 (46%)


Mouse    61 IVNISDSFEMTY-----RFCSQFSKGVYAIF---GFYERRTVNMLTSFCGALHVCFITPSFPVDT 117
            |::::.|..:|.     ..|:.::|.:..:|   |....:.||:|..          .|..||..
  Fly    37 ILSVTPSLVLTLCCRSNHTCNFYNKMMSTLFREWGLAPLQIVNVLRG----------VPWHPVPG 91

Mouse   118 SNQFVL----------QLRPELQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQV 172
            ...|.:          ::|.|......:..:||    |:::...||   :||..:....:..|: 
  Fly    92 RRHFNVIFTDSFAAFEEIRMEYYSREYNYNEHY----FIFLQARDR---LLQGEMRLIFDYCWR- 148

Mouse   173 TAVNILTTTEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIVKLEKNGIGYHYILANLGFMD 237
                        ||::...::.:|..               |.|:.......|.|      |..|
  Fly   149 ------------YRLIHCSIQVQKSN---------------GDILFYSYYPFGEH------GCSD 180

Mouse   238 ID---LNKFKESGANVTGFQLVNYTDTIPARIMQ---------QWRT-------SDARDHTRVDW 283
            ::   :|::       .|..||. .|..|.::..         .|..       .|..:..||:.
  Fly   181 MEPQLINRY-------NGSMLVE-PDLFPRKLRNFFGCPLRCALWDVPPFLTLDEDQEEVLRVNG 237

Mouse   284 -----------KRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDI 337
                       ::..:|.|:....|.:..||.:.|||..:|::..|                   
  Fly   238 GYEGRLLLALAEKMNFTIAVRKVHVNMRDEALEMLRRDEVDLTLGG------------------- 283

Mouse   338 QRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNS 402
               ::|....|:......|                                              
  Fly   284 ---IRQTVARGMVATSSHN---------------------------------------------- 299

Mouse   403 SVQNRTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCVELAA-EIAKHVGYSYRLEIVSDGKYGA 466
              .::|..|..:|...|                     ||:: :|   :.|.|||:|        
  Fly   300 --YHQTREVFGVLASSY---------------------ELSSFDI---LFYPYRLQI-------- 330

Mouse   467 RDPDTKAWNGMVG--------ELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQK 523
                   |.|::|        :|:.||           ::||.                      
  Fly   331 -------WMGILGVVALSALIQLIVGR-----------MLRER---------------------- 355

Mouse   524 SKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIF 588
                       :....|:.:...::|:.::                                   
  Fly   356 -----------MGSRFWLNLELVFVGMPLL----------------------------------- 374

Mouse   589 NSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFL----------TVERM 643
                         .|   |||.:.|:...:...:||||.:.|...|...:          |:|.:
  Fly   375 -------------EC---PRSHTARLYCVMLMMYTLIIRTIYQGLLYHLIRTHQLNRWPQTIESL 423

Mouse   644 V--------SPI--ESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVR 698
            |        :||  |..:::.....:.:..|||.|                     ..:|..|:.
  Fly   424 VQKNFTVVLTPIVQEVLDEIPSVQHMRFRLLEANS---------------------ELDPLYFLE 467

Mouse   699 TTEEGMIRVRKSKGKYAYLLESTMNEYIE-QRKPCDTMKVGGNLDSKGYGIATP----------- 751
            ...:    :|:      ::..|.::.:|. .|...|.:...|...|..:....|           
  Fly   468 ANHQ----LRQ------HVTASALDIFIHFNRLSADKVHQRGEQGSGAHFEIVPEDIISMQLTMY 522

Mouse   752 --KGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSGSKDKTSALSLSNVAGVFYILI 814
              |.|.|...:|..::.:...|:| .:.|:|     |.......::.....|....:..:|.:::
  Fly   523 LAKHSFLIDQLNEEIMWMRSVGLL-SVWSRW-----ELSESYLRNEQSFQVLGTMELYAIFLMVL 581

Mouse   815 GGLGLAMLVALIE 827
            .||.:.:||.::|
  Fly   582 VGLIVGLLVFILE 594

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385 56/376 (15%)
ANF_receptor 37..372 CDD:279440 56/359 (16%)
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 62/424 (15%)
Glutamate binding. {ECO:0000250} 492..494 0/2 (0%)
Lig_chan 538..817 CDD:278489 45/313 (14%)
Glutamate binding. {ECO:0000250} 668..669 1/1 (100%)
PDZ-binding 904..907
Ir7eNP_001138176.1 PBPb 218..>313 CDD:214497 19/165 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111187887
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.