DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and Ir7d

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_001138175.1 Gene:Ir7d FlyBaseID:FBgn0259190 Length:594 Species:Drosophila melanogaster

Alignment Length:448 Identity:79/449 (18%)
Similarity:155/449 (35%) Gaps:118/449 (26%)


Mouse   418 PYVMLK-KNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSD--GKYGARDPDTKAWNGMVG 479
            ||:.:. |:::..:|.|..:|..:.:   :|:.:.::.:| |.::  |..|........:.|...
  Fly   221 PYMRINWKSSDPMDGLDGLDGLLLRI---VARKMNFTLKL-IPNEPNGLIGGSSFMNGTFTGAYK 281

Mouse   480 ELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIV 544
            .|...||::.:.....|..|...::.:.|:..:...|::    :::.|         |.|:..::
  Fly   282 MLRERRANITIGCAACTPERSTFLEATSPYSQMSYIIVL----QARGG---------YSIYEVML 333

Mouse   545 FAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRS 609
            |.:  ......|:|......|                     |..|.|               |.
  Fly   334 FPF--EKYTWLLLSTILGLHW---------------------IVGSRW---------------RM 360

Mouse   610 LSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFR 674
            .|..:.|.:.|.|  :|.:||.|::..|:. ...|.|.....|.|......:.|..|.     :|
  Fly   361 PSPILAGWMLWIF--VIRASYEASVFNFIQ-NSPVKPSPRTLDQALSGGFRFITDHAS-----YR 417

Mouse   675 RS-KIAVFEKMWTYMKSAEP-SVFVRTTE---------------EGMIRVRKSKGKYAYLLESTM 722
            .: ||..|:.. |.:.:.:| .||....:               :.::|.||.:.:...|.|..:
  Fly   418 MTLKIPSFQGK-TLISAGQPVDVFDALLKAPWKTGAFTSRAFLADHLVRHRKHRNQLVILAEKIV 481

Mouse   723 NEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVL---------DKLKS 778
            :..:     |               :..|.||.....:|..:..:...|:.         |.|.:
  Fly   482 DNML-----C---------------MYFPHGSYFAWEINKLLFNMRSFGIFQHHSQILAWDNLPT 526

Mouse   779 KWWYDKGECGSKDSGSKDKTS---ALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSR 833
            .  .|....|.:...|.:..:   |.|:|.|......|:|.|.::::|..:|...:.|
  Fly   527 T--TDTDTPGKRIHSSTESVATGFAESMSFVVAALNCLMGALCISIVVFGLELLSRRR 582

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385
ANF_receptor 37..372 CDD:279440
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 67/398 (17%)
Glutamate binding. {ECO:0000250} 492..494 0/2 (0%)
Lig_chan 538..817 CDD:278489 54/308 (18%)
Glutamate binding. {ECO:0000250} 668..669 0/1 (0%)
PDZ-binding 904..907
Ir7dNP_001138175.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.