DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and Ir94d

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_001138099.1 Gene:Ir94d FlyBaseID:FBgn0259193 Length:593 Species:Drosophila melanogaster

Alignment Length:440 Identity:79/441 (18%)
Similarity:144/441 (33%) Gaps:152/441 (34%)


Mouse   466 ARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPG--- 527
            |||......||.| ::..|    |:.|      :.....:|.|...:...:|:..|::....   
  Fly   239 ARDLIASVQNGSV-QIALG----AIYP------QVPYTGYSYPIELMSWCLMMPVPEEVPHSQLY 292

Mouse   528 --VFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSR-------FSPYEWHSEEFEEGRDQTTSDQSN 583
              |||   |:|:.|   .:.|.:.:|:.|.:..|       ||.|..|.....            
  Fly   293 SMVFS---PMAFGI---TIVAMVLISLTLSMALRLHGYRVSFSEYFLHDSCLR------------ 339

Mouse   584 EFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIE 648
              |:.:..::.:   ::....|....|...::|       |:|.|.|.:..:.|:|.......:.
  Fly   340 --GVLSQSFYEV---LRAPALIKAMYLVICLLG-------LLITSWYNSYFSTFVTSAPRFPQLT 392

Mouse   649 SAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGK 713
            |.|.:                    |.|.|.:.  :|            :...|.::...::..|
  Fly   393 SYESI--------------------RHSNIKIV--IW------------KPEYEMLLFFSENMEK 423

Mouse   714 YA--YLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATP------------------------- 751
            |:  :.|:....|::..|...||.          ||...|                         
  Fly   424 YSSIFQLQEDYKEFLHLRDSFDTR----------YGYMMPMEKWSLMKEQQRVFSSPLFSLQDDL 478

Mouse   752 -------------KGSALRGPVNLAVLKLSEQGVLDKLKSKWWYD--------KGECGSKDSGSK 795
                         |.|..:.|.:..:|.::..|:|.:     |.|        .|:.|.:|.|..
  Fly   479 CVFHTVPIVFPMVKNSIFKEPFDRLILDVTATGLLSR-----WRDMSFTEMIKAGQLGLEDRGHP 538

Mouse   796 DKTSALSLSNVAGVFYILIGGLGLAMLVALIE-FCYKSRSESKRMK-GFC 843
            .:..|:.:.::..::..:...||||.:|.|:| .|:......:.|| .||
  Fly   539 KEFRAMKVGDLIQIWRFVGWMLGLATIVFLLELICFWRHKMWQNMKYMFC 588

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385
ANF_receptor 37..372 CDD:279440
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 63/381 (17%)
Glutamate binding. {ECO:0000250} 492..494 1/2 (50%)
Lig_chan 538..817 CDD:278489 49/334 (15%)
Glutamate binding. {ECO:0000250} 668..669 0/1 (0%)
PDZ-binding 904..907
Ir94dNP_001138099.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111064870
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.