DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and GluRIB

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_001261621.2 Gene:GluRIB FlyBaseID:FBgn0264000 Length:1182 Species:Drosophila melanogaster

Alignment Length:1029 Identity:413/1030 (40%)
Similarity:563/1030 (55%) Gaps:167/1030 (16%)


Mouse    14 GAVVGA----NFPNNIQIGGLFPNQQSQEHAAFRFA-----LSQLTEPPKLLPQIDIVNISDSFE 69
            |:.||.    :....|.:|.:|.....:..:||::|     |:..:...:|...:|::|.:|:|:
  Fly    27 GSGVGVSAQPSLTEKIPLGAIFEQGTDEVQSAFKYAMLNHNLNVSSRRFELQAYVDVINTADAFK 91

Mouse    70 MTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFP--VDTSN----QFVLQLRPE 128
            ::...|:|||:|||::.|.....:.:.|.|:.....:.|:||.||  |.|.:    .|.|.:||:
  Fly    92 LSRLICNQFSRGVYSMLGAVSPDSFDTLHSYSNTFQMPFVTPWFPEKVLTPSSGFLDFALSMRPD 156

Mouse   129 LQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLD--TAAEKNWQVTAVNILTTTEEGYRML--F 189
            ..:|:|..|..|.|:..:|:||:..||..||::..  ....:::||..|..::........|  .
  Fly   157 YHQAIIDTIQFYGWRKIIYLYDSHDGLLRLQQIYQGLRPGNESFQVELVKRISNVSMAIEFLHTL 221

Mouse   190 QDLEKKKERLVVVDCESERLNAILGQIVK-LEKNGIGYHYILANLGFMDIDLNKFKESGA-NVTG 252
            :.:.:.:.:.:|:||.:|....||.|.|: |......|||:|:.|...|...::..|.|| |:||
  Fly   222 EQIGRFENKHIVLDCPTEMAKQILIQHVRDLRLGRRTYHYLLSGLVMDDRWESEIIEFGAINITG 286

Mouse   253 FQLVNYTDTIPARIMQQWRTSDARDHTRVDWKRPKYTSALTYDGVKVMAEAFQSLRRQRID---- 313
            |::|:....:.......|:..|.:.......:.....:||.||.|.|:.|||..:.|::.|    
  Fly   287 FRIVDTNRRLVREFYDSWKRLDPQMSVGAGRESISAQAALMYDAVFVLVEAFNKILRKKPDQFRN 351

Mouse   314 -ISRR---------------------------GNAG---------------------DCLANPAV 329
             :.||                           ||.|                     ||  |.|.
  Fly   352 NVQRRSQTLMVAQAAASTSSDGYNYSASGGGGGNGGAGGGFAGSDSGGSGGMASRALDC--NTAK 414

Mouse   330 ----PWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMK-HDGIRKIGYWNEDDKFV 389
                .|..|..|.|.|::|..|||||:::||:.|||.||||||:||. :..:.|:..||:|....
  Fly   415 GWVNAWEHGDKISRYLRKVEIEGLTGDIKFNDDGRRVNYTLHVVEMTVNSAMVKVAEWNDDAGLQ 479

Mouse   390 PA-ATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNA--NQFEGNDRYEGYCVELAAEIAKHVG 451
            |. |...:........:||||||||:||:||:|||:.|  .:..||:|:||||.:||..:||.:|
  Fly   480 PLNAKYVRLRPHVEFEKNRTYIVTTVLEEPYIMLKQVAFGEKLHGNNRFEGYCKDLADLLAKELG 544

Mouse   452 YSYRLEIVSDGKYGARDPDTK-AWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGIS 515
            .:|.|.:|.||.||:...... .|:|||||||...||:|:|.:|||..||.||||||||||||||
  Fly   545 INYELRLVKDGNYGSEKSSAHGGWDGMVGELVRKEADIAIAAMTITAERERVIDFSKPFMSLGIS 609

Mouse   516 IMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEW--------------- 565
            ||||||.|..||||||::||:.|||:.::|:|||||:|||.||||||:||               
  Fly   610 IMIKKPVKQTPGVFSFMNPLSQEIWVSVIFSYIGVSIVLFFVSRFSPHEWRLVQQQPQQSQSPDP 674

Mouse   566 --HSEEF-----------------------------------------EEGRDQTTSDQSNEFGI 587
              |.|:.                                         ..|...::|...|||.:
  Fly   675 HAHHEQLANQQPPGIIGGAPLPAPPGPPTPGAQTAAGAAALQAALSAGSPGSGGSSSAVVNEFSV 739

Mouse   588 FNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED 652
            :||.||||.||||||||:||||:||||....|:|||||:||||||||||||||||||:||.|.||
  Fly   740 WNSFWFSLAAFMQQGCDLSPRSVSGRIAAASWFFFTLILISSYTANLAAFLTVERMVTPINSPED 804

Mouse   653 LAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYL 717
            ||.|||:.||||..|||.:|||||:|.:..|||.||.|.: .|||.|.:||:.|||.||||||.|
  Fly   805 LAMQTEVQYGTLLHGSTWDFFRRSQIGLHNKMWEYMNSRK-HVFVPTYDEGIKRVRNSKGKYALL 868

Mouse   718 LESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKWWY 782
            :||..|||:..|:||||||||.|||:||:|||||.||||:.|:|||||.|.|.|.|.||::||||
  Fly   869 VESPKNEYVNAREPCDTMKVGRNLDTKGFGIATPLGSALKDPINLAVLTLKENGELIKLRNKWWY 933

Mouse   783 DKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMKGFCLIPQ 847
            :|.||.:...| :...|.||||||||:||||||||.:::.||::|:|::||.......|..:   
  Fly   934 EKAECSTHKDG-ETSHSELSLSNVAGIFYILIGGLLVSVFVAILEYCFRSRDSRSASSGSGM--- 994

Mouse   848 QSINEAIRTSTLPRNSGAGASGGSGSGENGRVVSQDFPKSMQSIPCMSHSSGMP 901
                      .|....|.|.||||....||         ||...|..:...|||
  Fly   995 ----------GLGMGLGGGMSGGSLGKANG---------SMMLGPSSAVPGGMP 1029

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385 121/438 (28%)
ANF_receptor 37..372 CDD:279440 115/409 (28%)
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 245/442 (55%)
Glutamate binding. {ECO:0000250} 492..494 0/2 (0%)
Lig_chan 538..817 CDD:278489 182/337 (54%)
Glutamate binding. {ECO:0000250} 668..669 1/1 (100%)
PDZ-binding 904..907
GluRIBNP_001261621.2 PBP1_iGluR_AMPA 43..478 CDD:107375 121/437 (28%)
ANF_receptor 55..461 CDD:279440 115/408 (28%)
PBP2_iGluR_AMPA 497..938 CDD:270433 245/442 (55%)
Lig_chan 632..967 CDD:278489 182/337 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111105366
eggNOG 1 0.900 E1_KOG1052
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 707 1.000 Inparanoid score I644
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D89427at33208
OrthoFinder 1 1.000 FOG0000395
OrthoInspector 1 1.000 T130891
orthoMCL 1 0.900 OOG5_128645
Panther 1 1.100 O PTHR18966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
1110.860

Return to query results.
Submit another query.